OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CHAC1 (NM_024111) Human Mass Spec Standard

Be the first to review this product
SKU
PH300912
CHAC1 MS Standard C13 and N15-labeled recombinant protein (NP_077016)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA507052 CHAC1 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2) 100 ul
$447.00
LY411345 Transient overexpression lysate of ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CHAC1 or NM_024111"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200912
Predicted MW 24.4 kDa
Protein Sequence
Protein Sequence
>RC200912 protein sequence
Red=Cloning site Green=Tags(s)

MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTF
HRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKA
LAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLP
CFCPTEQALALV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077016
RefSeq Size 1578
RefSeq ORF 666
Locus ID 79094
UniProt ID Q9BUX1
Cytogenetics 15q15.1
Summary This gene encodes a member of the gamma-glutamylcyclotransferase family of proteins. The encoded protein has been shown to promote neuronal differentiation by deglycination of the Notch receptor, which prevents receptor maturation and inhibits Notch signaling. This protein may also play a role in the unfolded protein response, and in regulation of glutathione levels and oxidative balance in the cell. Elevated expression of this gene may indicate increased risk of cancer recurrence among breast and ovarian cancer patients. provided by RefSeq, Sep 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CHAC1" proteins (7)
SKU Description Size Price
PH327708 CHAC1 MS Standard C13 and N15-labeled recombinant protein (NP_001136248) 10 ug
$3,360.00
LC411345 Lyophilized CHAC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432159 Lyophilized CHAC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411345 Transient overexpression lysate of ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY432159 Transient overexpression lysate of ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP300912 Recombinant protein of human ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 1, 20 µg 20 ug
$867.00
TP327708 Purified recombinant protein of Homo sapiens ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products