CHAC1 (NM_024111) Human Tagged ORF Clone

  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

SKU
RC200912
CHAC1 (Myc-DDK-tagged)-Human ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 1
$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CHAC1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200912 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCAGGAGTCTGCAGCCCCGAACACCCCGCCCACCTCGCAGTCCCCTACGCCGTCCGCTCAGTTCC
CCCGAAACGACGGCGACCCTCAAGCGCTGTGGATTTTCGGGTACGGCTCCCTGGTGTGGAGGCCCGACTT
CGCCTACAGCGACAGCCGTGTGGGCTTCGTGCGCGGCTACAGCCGCCGTTTCTGGCAGGGAGACACCTTC
CATCGGGGCAGCGACAAGATGCCTGGCCGTGTGGTGACGCTCCTTGAAGATCATGAGGGCTGCACTTGGG
GCGTGGCATACCAAGTGCAAGGGGAGCAGGTAAGCAAGGCCCTGAAGTACCTGAATGTGCGAGAGGCAGT
GCTTGGTGGCTACGATACCAAGGAGGTCACCTTCTATCCCCAAGATGCTCCTGACCAACCACTGAAGGCA
TTGGCCTATGTGGCCACCCCACAGAACCCTGGTTACCTGGGCCCTGCGCCTGAAGAGGCCATTGCCACGC
AGATCCTGGCCTGCCGGGGCTTCTCCGGCCACAACCTTGAATACTTGCTGCGTCTGGCAGACTTCATGCA
GCTCTGTGGGCCTCAGGCGCAGGACGAGCACCTGGCAGCCATCGTGGACGCTGTGGGCACCATGTTGCCC
TGCTTCTGCCCCACCGAGCAGGCTCTGGCGCTGGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200912 protein sequence
Red=Cloning site Green=Tags(s)

MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTF
HRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKA
LAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLP
CFCPTEQALALV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_024111
ORF Size 666 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024111.6
RefSeq Size 1578 bp
RefSeq ORF 669 bp
Locus ID 79094
UniProt ID Q9BUX1
Cytogenetics 15q15.1
Domains ChaC
MW 24.4 kDa
Summary This gene encodes a member of the gamma-glutamylcyclotransferase family of proteins. The encoded protein has been shown to promote neuronal differentiation by deglycination of the Notch receptor, which prevents receptor maturation and inhibits Notch signaling. This protein may also play a role in the unfolded protein response, and in regulation of glutathione levels and oxidative balance in the cell. Elevated expression of this gene may indicate increased risk of cancer recurrence among breast and ovarian cancer patients. [provided by RefSeq, Sep 2016]
 
 
 
 
 
Be the first to review this product
SKU Description Size Price
RC200912L1 Lenti ORF clone of Human ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RC200912L2 Lenti ORF clone of Human ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 1, mGFP tagged 10 ug
$750.00
RC200912L3 Lenti ORF clone of Human ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RC200912L4 Lenti ORF clone of Human ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 1, mGFP tagged 10 ug
$750.00
RC229135 CHAC1 (Myc-DDK-tagged)-Human ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 1 10 ug
$450.00
RC229135L1 Lenti ORF clone of Human ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RC229135L3 Lenti ORF clone of Human ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RG200912 CHAC1 (tGFP-tagged) - Human ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 1 10 ug
$650.00
RG229135 CHAC1 (tGFP-tagged) - Human ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 1 10 ug
$650.00
SC111411 CHAC1 (untagged)-Human ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 1 10 ug
$450.00
SC327770 CHAC1 (untagged)-Human ChaC cation transport regulator homolog 1 (E. coli) (CHAC1) transcript variant 1 10 ug
$734.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.