CHAC1 (NM_001142776) Human Mass Spec Standard

SKU
PH327708
CHAC1 MS Standard C13 and N15-labeled recombinant protein (NP_001136248)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227708]
Predicted MW 23.6 kDa
Protein Sequence
Protein Sequence
>RC227708 representing NM_001142776
Red=Cloning site Green=Tags(s)

MGGAQLELPSGARPGVCVRRSFRAHAGDQPRRPPGPIPVPGTMKQESAAPNTPPTSQSPTPSAQFPRNDG
DPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQ
VQGEQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFC
PTEQALALV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001136248
RefSeq ORF 657
Locus ID 79094
UniProt ID Q9BUX1
Cytogenetics 15q15.1
Summary This gene encodes a member of the gamma-glutamylcyclotransferase family of proteins. The encoded protein has been shown to promote neuronal differentiation by deglycination of the Notch receptor, which prevents receptor maturation and inhibits Notch signaling. This protein may also play a role in the unfolded protein response, and in regulation of glutathione levels and oxidative balance in the cell. Elevated expression of this gene may indicate increased risk of cancer recurrence among breast and ovarian cancer patients. [provided by RefSeq, Sep 2016]
Write Your Own Review
You're reviewing:CHAC1 (NM_001142776) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300912 CHAC1 MS Standard C13 and N15-labeled recombinant protein (NP_077016) 10 ug
$3,255.00
LC411345 CHAC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432159 CHAC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411345 Transient overexpression lysate of ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 1 100 ug
$436.00
LY432159 Transient overexpression lysate of ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 1 100 ug
$436.00
TP300912 Recombinant protein of human ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 1, 20 µg 20 ug
$867.00
TP327708 Purified recombinant protein of Homo sapiens ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.