OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CYBC1 (NM_001033046) Human Mass Spec Standard

Be the first to review this product
SKU
PH300883
C17orf62 MS Standard C13 and N15-labeled recombinant protein (NP_001028218)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA506979 C17orf62 mouse monoclonal antibody, clone OTI3B5 (formerly 3B5) 100 ul
$447.00
LY420251 Transient overexpression lysate of chromosome 17 open reading frame 62 (C17orf62), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CYBC1 or NM_001033046"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200883
Predicted MW 20.8 kDa
Protein Sequence
Protein Sequence
>RC200883 protein sequence
Red=Cloning site Green=Tags(s)

MYLQVETRTSSRLHLKRAPGIRSWSLLVGILSIGLAAAYYSGDSLGWKLFYVTGCLFVAVQNLEDWEEAI
FDKSTGKVVLKTFSLYKKLLTLFRAGHDQVVVLLHDVRDVSVEEEKVRYFGKGYMVVLRLATGFSHPLTQ
SAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001028218
RefSeq Size 2167
RefSeq ORF 561
Synonyms C17orf62; CGD5; Eros
Locus ID 79415
UniProt ID Q9BQA9
Cytogenetics 17q25.3
Summary Necessary for a stable expression of the CYBA and CYBB subunits of the cytochrome b-245 hetrodimer. Controls the phagocyte respiratory burst and is essential for innate immunity.UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CYBC1" proteins (7)
SKU Description Size Price
LC420251 Lyophilized C17orf62 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420252 Lyophilized C17orf62 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422350 Lyophilized C17orf62 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420251 Transient overexpression lysate of chromosome 17 open reading frame 62 (C17orf62), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420252 Transient overexpression lysate of chromosome 17 open reading frame 62 (C17orf62), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY422350 Transient overexpression lysate of chromosome 17 open reading frame 62 (C17orf62), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP300883 Recombinant protein of human chromosome 17 open reading frame 62 (C17orf62), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products