CYBC1 (NM_001033046) Human Recombinant Protein

SKU
TP300883
Recombinant protein of human chromosome 17 open reading frame 62 (C17orf62), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200883 protein sequence
Red=Cloning site Green=Tags(s)

MYLQVETRTSSRLHLKRAPGIRSWSLLVGILSIGLAAAYYSGDSLGWKLFYVTGCLFVAVQNLEDWEEAI
FDKSTGKVVLKTFSLYKKLLTLFRAGHDQVVVLLHDVRDVSVEEEKVRYFGKGYMVVLRLATGFSHPLTQ
SAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 20.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001028218
Locus ID 79415
UniProt ID Q9BQA9
Cytogenetics 17q25.3
RefSeq Size 2167
RefSeq ORF 561
Synonyms C17orf62; CGD5; Eros
Summary Necessary for a stable expression of the CYBA and CYBB subunits of the cytochrome b-245 hetrodimer. Controls the phagocyte respiratory burst and is essential for innate immunity.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:CYBC1 (NM_001033046) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300883 C17orf62 MS Standard C13 and N15-labeled recombinant protein (NP_001028218) 10 ug
$3,255.00
LC420251 C17orf62 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420252 C17orf62 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422350 C17orf62 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY420251 Transient overexpression lysate of chromosome 17 open reading frame 62 (C17orf62), transcript variant 1 100 ug
$436.00
LY420252 Transient overexpression lysate of chromosome 17 open reading frame 62 (C17orf62), transcript variant 3 100 ug
$436.00
LY422350 Transient overexpression lysate of chromosome 17 open reading frame 62 (C17orf62), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.