CYBC1 (NM_001033046) Human Tagged ORF Clone

SKU
RC200883
C17orf62 (Myc-DDK-tagged)-Human chromosome 17 open reading frame 62 (C17orf62), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CYBC1
Synonyms C17orf62; CGD5; Eros
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200883 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTACCTGCAGGTGGAGACCCGCACCAGCTCCCGCCTCCATCTGAAGAGGGCTCCAGGCATCCGGTCCT
GGTCCCTGCTGGTTGGAATCTTGTCGATTGGCCTGGCTGCTGCCTACTACAGCGGAGATAGCCTGGGCTG
GAAGCTCTTCTACGTCACAGGCTGCCTGTTTGTGGCTGTGCAGAACTTGGAGGACTGGGAGGAAGCCATC
TTCGACAAGAGCACAGGGAAGGTTGTTTTGAAGACGTTCAGCCTCTACAAGAAGCTGCTGACTCTTTTCA
GAGCTGGCCACGACCAGGTGGTGGTCCTGCTCCATGATGTCCGTGATGTGAGCGTGGAGGAGGAGAAGGT
CCGGTACTTCGGGAAAGGCTACATGGTGGTGCTCCGGCTTGCGACGGGCTTCTCCCACCCCCTCACGCAG
AGTGCAGTCATGGGCCACCGCAGTGATGTGGAAGCCATCGCCAAGCTCATCACCAGCTTCCTGGAGCTGC
ACTGCCTTGAGAGCCCCACAGAGCTGTCTCAGAGCAGCGACAGTGAGGCCGGTGACCCTGCAAGCCAGAG
C


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200883 protein sequence
Red=Cloning site Green=Tags(s)

MYLQVETRTSSRLHLKRAPGIRSWSLLVGILSIGLAAAYYSGDSLGWKLFYVTGCLFVAVQNLEDWEEAI
FDKSTGKVVLKTFSLYKKLLTLFRAGHDQVVVLLHDVRDVSVEEEKVRYFGKGYMVVLRLATGFSHPLTQ
SAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001033046
ORF Size 561 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001033046.4
RefSeq Size 2167 bp
RefSeq ORF 564 bp
Locus ID 79415
UniProt ID Q9BQA9
Cytogenetics 17q25.3
Protein Families Transmembrane
MW 20.8 kDa
Summary Necessary for a stable expression of the CYBA and CYBB subunits of the cytochrome b-245 hetrodimer. Controls the phagocyte respiratory burst and is essential for innate immunity.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:CYBC1 (NM_001033046) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200883L3 Lenti ORF clone of Human chromosome 17 open reading frame 62 (C17orf62), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC200883L4 Lenti ORF clone of Human chromosome 17 open reading frame 62 (C17orf62), transcript variant 2, mGFP tagged 10 ug
$600.00
RG200883 C17orf62 (tGFP-tagged) - Human chromosome 17 open reading frame 62 (C17orf62), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC324452 C17orf62 (untagged)-Human chromosome 17 open reading frame 62 (C17orf62), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.