CYBC1 (NM_001033046) Human Mass Spec Standard

SKU
PH300883
C17orf62 MS Standard C13 and N15-labeled recombinant protein (NP_001028218)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200883]
Predicted MW 20.8 kDa
Protein Sequence
Protein Sequence
>RC200883 protein sequence
Red=Cloning site Green=Tags(s)

MYLQVETRTSSRLHLKRAPGIRSWSLLVGILSIGLAAAYYSGDSLGWKLFYVTGCLFVAVQNLEDWEEAI
FDKSTGKVVLKTFSLYKKLLTLFRAGHDQVVVLLHDVRDVSVEEEKVRYFGKGYMVVLRLATGFSHPLTQ
SAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001028218
RefSeq Size 2167
RefSeq ORF 561
Synonyms C17orf62; CGD5; Eros
Locus ID 79415
UniProt ID Q9BQA9
Cytogenetics 17q25.3
Summary Necessary for a stable expression of the CYBA and CYBB subunits of the cytochrome b-245 hetrodimer. Controls the phagocyte respiratory burst and is essential for innate immunity.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:CYBC1 (NM_001033046) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC420251 C17orf62 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420252 C17orf62 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422350 C17orf62 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY420251 Transient overexpression lysate of chromosome 17 open reading frame 62 (C17orf62), transcript variant 1 100 ug
$436.00
LY420252 Transient overexpression lysate of chromosome 17 open reading frame 62 (C17orf62), transcript variant 3 100 ug
$436.00
LY422350 Transient overexpression lysate of chromosome 17 open reading frame 62 (C17orf62), transcript variant 2 100 ug
$436.00
TP300883 Recombinant protein of human chromosome 17 open reading frame 62 (C17orf62), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.