OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

robld3 (LAMTOR2) (NM_014017) Human Mass Spec Standard

Be the first to review this product
SKU
PH300862
ROBLD3 MS Standard C13 and N15-labeled recombinant protein (NP_054736)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349022 Rabbit Polyclonal Anti-LAMTOR2 Antibody
100 ug
$640.00
LY415522 Transient overexpression lysate of roadblock domain containing 3 (ROBLD3), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "robld3 or NM_014017"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200862
Predicted MW 13.5 kDa
Protein Sequence
Protein Sequence
>RC200862 protein sequence
Red=Cloning site Green=Tags(s)

MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLK
FILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_054736
RefSeq Size 699
RefSeq ORF 375
Synonyms ENDAP; HSPC003; MAPBPIP; MAPKSP1AP; p14; Ragulator2; ROBLD3
Locus ID 28956
UniProt ID Q9Y2Q5
Cytogenetics 1q22
Summary The product of this gene is highly conserved with a mouse protein associated with the cytoplasmic face of late endosomes and lysosomes. The mouse protein interacts with MAPK scaffold protein 1, a component of the mitogen-activated protein kinase pathway. In humans, a mutation in this gene has been associated with a primary immunodeficiency syndrome, and suggests a role for this protein in endosomal biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Feb 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "robld3" proteins (3)
SKU Description Size Price
LC415522 Lyophilized LAMTOR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415522 Transient overexpression lysate of roadblock domain containing 3 (ROBLD3), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP300862 Recombinant protein of human roadblock domain containing 3 (ROBLD3), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products