OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EIF5A (NM_001970) Human Mass Spec Standard

Be the first to review this product
SKU
PH300770
EIF5A MS Standard C13 and N15-labeled recombinant protein (NP_001961)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA384164 eIF5A Rabbit monoclonal Antibody
100 ul
$380.00
LY419616 Transient overexpression lysate of eukaryotic translation initiation factor 5A (EIF5A), transcript variant B (as WB positive control) 100 ug
$436.00

Other products for "EIF5A or NM_001970"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200770
Predicted MW 16.8 kDa
Protein Sequence
Protein Sequence
>RC200770 protein sequence
Red=Cloning site Green=Tags(s)

MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYE
DICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSA
MTEEAAVAIKAMAK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001961
RefSeq Size 1355
RefSeq ORF 462
Synonyms eIF-4D; EIF-5A; EIF5A1; eIF5AI
Locus ID 1984
UniProt ID P63241
Cytogenetics 17p13.1
Summary mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. With syntenin SDCBP, functions as a regulator of p53/TP53 and p53/TP53-dependent apoptosis. Regulates also TNF-alpha-mediated apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation. Also described as a cellular cofactor of human T-cell leukemia virus type I (HTLV-1) Rex protein and of human immunodeficiency virus type 1 (HIV-1) Rev protein, essential for mRNA export of retroviral transcripts.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EIF5A" proteins (11)
SKU Description Size Price
PH326600 EIF5A MS Standard C13 and N15-labeled recombinant protein (NP_001137233) 10 ug
$3,360.00
PH326664 EIF5A MS Standard C13 and N15-labeled recombinant protein (NP_001137234) 10 ug
$3,360.00
LC419616 Lyophilized EIF5A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428326 Lyophilized EIF5A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428327 Lyophilized EIF5A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419616 Transient overexpression lysate of eukaryotic translation initiation factor 5A (EIF5A), transcript variant B (as WB positive control) 100 ug
$436.00
LY428326 Transient overexpression lysate of eukaryotic translation initiation factor 5A (EIF5A), transcript variant C (as WB positive control) 100 ug
$436.00
LY428327 Transient overexpression lysate of eukaryotic translation initiation factor 5A (EIF5A), transcript variant D (as WB positive control) 100 ug
$436.00
TP300770 Recombinant protein of human eukaryotic translation initiation factor 5A (EIF5A), transcript variant B, 20 µg 20 ug
$737.00
TP326600 Recombinant protein of human eukaryotic translation initiation factor 5A (EIF5A), transcript variant C, 20 µg 20 ug
$737.00
TP326664 Recombinant protein of human eukaryotic translation initiation factor 5A (EIF5A), transcript variant D, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products