OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GNAT2 (NM_005272) Human Mass Spec Standard

Be the first to review this product
SKU
PH300685
GNAT2 MS Standard C13 and N15-labeled recombinant protein (NP_005263)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA308890 Rabbit Polyclonal antibody to GNAT2 (guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2)
100 ul
$665.00
LY401620 Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 (GNAT2) (as WB positive control) 100 ug
$436.00

Other products for "GNAT2 or NM_005272"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200685
Predicted MW 40.2 kDa
Protein Sequence
Protein Sequence
>RC200685 protein sequence
Red=Cloning site Green=Tags(s)

MGSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEFK
AIIYGNVLQSILAIIRAMTTLGIDYAEPSCADDGRQLNNLADSIEEGTMPPELVEVIRRLWKDGGVQACF
ERAAEYQLNDSASYYLNQLERITDPEYLPSEQDVLRSRVKTTGIIETKFSVKDLNFRMFDVGGQRSERKK
WIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKK
VHLSICFPEYDGNNSYDDAGNYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKD
CGLF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005263
RefSeq Size 1384
RefSeq ORF 1062
Synonyms ACHM4; GNATC
Locus ID 2780
UniProt ID P19087
Cytogenetics 1p13.3
Summary Transducin is a 3-subunit guanine nucleotide-binding protein (G protein) which stimulates the coupling of rhodopsin and cGMP-phoshodiesterase during visual impulses. The transducin alpha subunits in rods and cones are encoded by separate genes. This gene encodes the alpha subunit in cones. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GNAT2" proteins (3)
SKU Description Size Price
LC401620 Lyophilized GNAT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401620 Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 (GNAT2) (as WB positive control) 100 ug
$436.00
TP300685 Recombinant protein of human guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 (GNAT2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products