DDOST (NM_005216) Human Mass Spec Standard

CAT#: PH300672

DDOST MS Standard C13 and N15-labeled recombinant protein (NP_005207)

Product Images

Coomassie blue staining of purified DDOST protein (Cat# TP300672). The protein was produced from HEK293T cells transfected with DDOST cDNA clone (Cat# RC200672) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200672
• Predicted MW: 50.7 kDa
• Protein Sequence:
  Sequence Link

  >RC200672 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGYFRCAGAGSFGRRRKMEPSTAARAWALFWLLLPLLGAVCASGPRTLVLLDNLNVRETHSLFFRSLKDR
  GFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRE
  LGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPL
  VLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGS
  QRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDG
  DDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYER
  FIPSAYPYYASAFSMMLGLFIFSIVFLHMKEKEKSD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005207
• RefSeq Size: 2144
• RefSeq ORF: 1368
• Synonyms: AGER1; CDG1R; GATD6; OKSWcl45; OST; OST48; WBP1
• Locus ID: 1650
• UniProt ID: P39656, A0A024RAD5
• Cytogenetics: 1p36.12
• Summary: This gene encodes a component of the oligosaccharyltransferase complex which catalyzes the transfer of high-mannose oligosaccharides to asparagine residues on nascent polypeptides in the lumen of the rough endoplasmic reticulum. The protein complex co-purifies with ribosomes. The product of this gene is also implicated in the processing of advanced glycation endproducts (AGEs), which form from non-enzymatic reactions between sugars and proteins or lipids and are associated with aging and hyperglycemia. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, N-Glycan biosynthesis