CD79B (NM_001039933) Human Mass Spec Standard

CAT#: PH300665

CD79B MS Standard C13 and N15-labeled recombinant protein (NP_001035022)

Product Images

Coomassie blue staining of purified CD79B protein (Cat# TP300665). The protein was produced from HEK293T cells transfected with CD79B cDNA clone (Cat# RC200665) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200665
• Predicted MW: 26.05 kDa
• Protein Sequence:
  Sequence Link

  >RC200665 representing NM_001039933
  Red=Cloning site Green=Tags(s)
  
  MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSA
  SGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTEL
  RVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDI
  VTLRTGEVKWSVGEHPGQE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001035022
• RefSeq Size: 1303
• RefSeq ORF: 1428
• Synonyms: AGM6; B29; IGB
• Locus ID: 974
• UniProt ID: P40259
• Cytogenetics: 17q23.3
• Summary: The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: B cell receptor signaling pathway