OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ID3 (NM_002167) Human Mass Spec Standard

Be the first to review this product
SKU
PH300583
ID3 MS Standard C13 and N15-labeled recombinant protein (NP_002158)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA500713 ID3 mouse monoclonal antibody, clone OTI8B3 (formerly 8B3) 100 ul
$447.00
LY419492 Transient overexpression lysate of inhibitor of DNA binding 3, dominant negative helix-loop-helix protein (ID3) (as WB positive control) 100 ug
$436.00

Other products for "ID3 or NM_002167"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200583
Predicted MW 13 kDa
Protein Sequence
Protein Sequence
>RC200583 protein sequence
Red=Cloning site Green=Tags(s)

MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEIL
QRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002158
RefSeq Size 1252
RefSeq ORF 357
Synonyms bHLHb25; HEIR-1
Locus ID 3399
UniProt ID Q02535
Cytogenetics 1p36.12
Summary The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it interacts. provided by RefSeq, Aug 2011
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
Protein Pathways TGF-beta signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ID3" proteins (3)
SKU Description Size Price
LC419492 Lyophilized ID3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419492 Transient overexpression lysate of inhibitor of DNA binding 3, dominant negative helix-loop-helix protein (ID3) (as WB positive control) 100 ug
$436.00
TP300583 Recombinant protein of human inhibitor of DNA binding 3, dominant negative helix-loop-helix protein (ID3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products