OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LDOC1 (NM_012317) Human Mass Spec Standard

Be the first to review this product
SKU
PH300543
LDOC1 MS Standard C13 and N15-labeled recombinant protein (NP_036449)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505057 LDOC1 mouse monoclonal antibody, clone OTI1A2 (formerly 1A2) 100 ul
$447.00
LY402194 Transient overexpression lysate of leucine zipper, down-regulated in cancer 1 (LDOC1) (as WB positive control) 100 ug
$436.00

Other products for "LDOC1 or NM_012317"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200543
Predicted MW 17 kDa
Protein Sequence
Protein Sequence
>RC200543 protein sequence
Red=Cloning site Green=Tags(s)

MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQ
TASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDE
EEEDDY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036449
RefSeq Size 1470
RefSeq ORF 438
Synonyms BCUR1; Mar7; Mart7; RTL7; SIRH7
Locus ID 23641
UniProt ID O95751
Cytogenetics Xq27.1
Summary The protein encoded by this gene contains a leucine zipper-like motif and a proline-rich region that shares marked similarity with an SH3-binding domain. The protein localizes to the nucleus and is down-regulated in some cancer cell lines. It is thought to regulate the transcriptional response mediated by the nuclear factor kappa B (NF-kappaB). The gene has been proposed as a tumor suppressor gene whose protein product may have an important role in the development and/or progression of some cancers. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LDOC1" proteins (3)
SKU Description Size Price
LC402194 Lyophilized LDOC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402194 Transient overexpression lysate of leucine zipper, down-regulated in cancer 1 (LDOC1) (as WB positive control) 100 ug
$436.00
TP300543 Recombinant protein of human leucine zipper, down-regulated in cancer 1 (LDOC1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products