LDOC1 (NM_012317) Human Tagged ORF Clone

SKU
RC200543
LDOC1 (Myc-DDK-tagged)-Human leucine zipper, down-regulated in cancer 1 (LDOC1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LDOC1
Synonyms BCUR1; Mar7; Mart7; RTL7; SIRH7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200543 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGGATGAGTTGGTGCTGCTGCTGCACGCGCTCCTGATGCGGCACCGCGCCCTGAGCATCGAGAACA
GCCAGCTCATGGAACAGCTGCGGCTGCTGGTGTGCGAGAGGGCCAGCCTGCTGCGCCAGGTACGTCCGCC
GAGCTGCCCGGTGCCCTTCCCCGAAACGTTTAATGGCGAGAGCTCCCGGCTCCCCGAGTTTATCGTGCAG
ACGGCGTCTTACATGCTCGTGAACGAGAACCGATTCTGCAACGACGCCATGAAGGTGGCATTCCTAATCA
GCCTCCTCACCGGGGAAGCCGAGGAGTGGGTGGTGCCCTACATCGAGATGGATAGCCCCATCCTAGGTGA
TTACCGGGCCTTCCTCGATGAGATGAAACAGTGCTTTGGCTGGGATGACGACGAAGACGACGACGACGAA
GAAGAGGAGGATGATTAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200543 protein sequence
Red=Cloning site Green=Tags(s)

MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQ
TASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDE
EEEDDY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_012317
ORF Size 438 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012317.4
RefSeq Size 1470 bp
RefSeq ORF 441 bp
Locus ID 23641
UniProt ID O95751
Cytogenetics Xq27.1
MW 17 kDa
Summary The protein encoded by this gene contains a leucine zipper-like motif and a proline-rich region that shares marked similarity with an SH3-binding domain. The protein localizes to the nucleus and is down-regulated in some cancer cell lines. It is thought to regulate the transcriptional response mediated by the nuclear factor kappa B (NF-kappaB). The gene has been proposed as a tumor suppressor gene whose protein product may have an important role in the development and/or progression of some cancers. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:LDOC1 (NM_012317) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200543L1 Lenti ORF clone of Human leucine zipper, down-regulated in cancer 1 (LDOC1), Myc-DDK-tagged 10 ug
$450.00
RC200543L2 Lenti ORF clone of Human leucine zipper, down-regulated in cancer 1 (LDOC1), mGFP tagged 10 ug
$450.00
RC200543L3 Lenti ORF clone of Human leucine zipper, down-regulated in cancer 1 (LDOC1), Myc-DDK-tagged 10 ug
$450.00
RC200543L4 Lenti ORF clone of Human leucine zipper, down-regulated in cancer 1 (LDOC1), mGFP tagged 10 ug
$450.00
RG200543 LDOC1 (tGFP-tagged) - Human leucine zipper, down-regulated in cancer 1 (LDOC1) 10 ug
$489.00
SC111211 LDOC1 (untagged)-Human leucine zipper, down-regulated in cancer 1 (LDOC1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.