LDOC1 (NM_012317) Human Tagged ORF Clone
SKU
RC200543
LDOC1 (Myc-DDK-tagged)-Human leucine zipper, down-regulated in cancer 1 (LDOC1)
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | LDOC1 |
Synonyms | BCUR1; Mar7; Mart7; RTL7; SIRH7 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC200543 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGTGGATGAGTTGGTGCTGCTGCTGCACGCGCTCCTGATGCGGCACCGCGCCCTGAGCATCGAGAACA GCCAGCTCATGGAACAGCTGCGGCTGCTGGTGTGCGAGAGGGCCAGCCTGCTGCGCCAGGTACGTCCGCC GAGCTGCCCGGTGCCCTTCCCCGAAACGTTTAATGGCGAGAGCTCCCGGCTCCCCGAGTTTATCGTGCAG ACGGCGTCTTACATGCTCGTGAACGAGAACCGATTCTGCAACGACGCCATGAAGGTGGCATTCCTAATCA GCCTCCTCACCGGGGAAGCCGAGGAGTGGGTGGTGCCCTACATCGAGATGGATAGCCCCATCCTAGGTGA TTACCGGGCCTTCCTCGATGAGATGAAACAGTGCTTTGGCTGGGATGACGACGAAGACGACGACGACGAA GAAGAGGAGGATGATTAT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC200543 protein sequence
Red=Cloning site Green=Tags(s) MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQ TASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDE EEEDDY myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_012317 |
ORF Size | 438 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_012317.4 |
RefSeq Size | 1470 bp |
RefSeq ORF | 441 bp |
Locus ID | 23641 |
UniProt ID | O95751 |
Cytogenetics | Xq27.1 |
MW | 17 kDa |
Summary | The protein encoded by this gene contains a leucine zipper-like motif and a proline-rich region that shares marked similarity with an SH3-binding domain. The protein localizes to the nucleus and is down-regulated in some cancer cell lines. It is thought to regulate the transcriptional response mediated by the nuclear factor kappa B (NF-kappaB). The gene has been proposed as a tumor suppressor gene whose protein product may have an important role in the development and/or progression of some cancers. [provided by RefSeq, Jul 2008] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC200543L1 | Lenti ORF clone of Human leucine zipper, down-regulated in cancer 1 (LDOC1), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC200543L2 | Lenti ORF clone of Human leucine zipper, down-regulated in cancer 1 (LDOC1), mGFP tagged | 10 ug |
$450.00
|
|
RC200543L3 | Lenti ORF clone of Human leucine zipper, down-regulated in cancer 1 (LDOC1), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC200543L4 | Lenti ORF clone of Human leucine zipper, down-regulated in cancer 1 (LDOC1), mGFP tagged | 10 ug |
$450.00
|
|
RG200543 | LDOC1 (tGFP-tagged) - Human leucine zipper, down-regulated in cancer 1 (LDOC1) | 10 ug |
$489.00
|
|
SC111211 | LDOC1 (untagged)-Human leucine zipper, down-regulated in cancer 1 (LDOC1) | 10 ug |
$150.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.