OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SCAMP2 (NM_005697) Human Mass Spec Standard

Be the first to review this product
SKU
PH300262
SCAMP2 MS Standard C13 and N15-labeled recombinant protein (NP_005688)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA506991 SCAMP2 mouse monoclonal antibody, clone OTI3C2 (formerly 3C2) 100 ul
$447.00
LY417127 Transient overexpression lysate of secretory carrier membrane protein 2 (SCAMP2) (as WB positive control) 100 ug
$436.00

Other products for "SCAMP2 or NM_005697"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200262
Predicted MW 36.6 kDa
Protein Sequence
Protein Sequence
>RC200262 protein sequence
Red=Cloning site Green=Tags(s)

MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPT
QPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTE
IPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFSGNSSKGVDFGLSILWFLIFTPCAFLCWYRPIYKAF
RSDNSFSFFVFFFVFFCQIGIYIIQLVGIPGLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSV
FLLQRVHSLYRRTGASFQQAQEEFSQGIFSSRTFHRAASSAAQGAFQGN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005688
RefSeq Size 1313
RefSeq ORF 987
Locus ID 10066
UniProt ID O15127
Cytogenetics 15q24.1
Summary This gene product belongs to the SCAMP family of proteins which are secretory carrier membrane proteins. They function as carriers to the cell surface in post-golgi recycling pathways. Different family members are highly related products of distinct genes, and are usually expressed together. These findings suggest that the SCAMPs may function at the same site during vesicular transport rather than in separate pathways. Alternate splicing results in multiple transcript variants. provided by RefSeq, Mar 2016
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SCAMP2" proteins (3)
SKU Description Size Price
LC417127 Lyophilized SCAMP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417127 Transient overexpression lysate of secretory carrier membrane protein 2 (SCAMP2) (as WB positive control) 100 ug
$436.00
TP300262 Recombinant protein of human secretory carrier membrane protein 2 (SCAMP2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products