OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EB2 (MAPRE2) (NM_014268) Human Mass Spec Standard

Be the first to review this product
SKU
PH300259
MAPRE2 MS Standard C13 and N15-labeled recombinant protein (NP_055083)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502858 MAPRE2 (EB2) mouse monoclonal antibody, clone OTI1F3 (formerly 1F3) 100 ul
$447.00
LY415395 Transient overexpression lysate of microtubule-associated protein, RP/EB family, member 2 (MAPRE2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "EB2 or NM_014268"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200259
Predicted MW 37 kDa
Protein Sequence
Protein Sequence
>RC200259 protein sequence
Red=Cloning site Green=Tags(s)

MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDI
VSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLV
KGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSP
AAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQ
EHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055083
RefSeq Size 4279
RefSeq ORF 981
Synonyms CSCSC2; EB1; EB2; RP1
Locus ID 10982
UniProt ID Q15555
Cytogenetics 18q12.1-q12.2
Summary The protein encoded by this gene shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family. This protein is a microtubule-associated protein that is necessary for spindle symmetry during mitosis. It is thought to play a role in the tumorigenesis of colorectal cancers and the proliferative control of normal cells. Alternative splicing of this gene results in multiple transcript variants. provided by RefSeq, Jan 2012
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EB2" proteins (9)
SKU Description Size Price
PH326779 MAPRE2 MS Standard C13 and N15-labeled recombinant protein (NP_001137299) 10 ug
$3,360.00
LC415395 Lyophilized MAPRE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428369 Lyophilized MAPRE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428370 Lyophilized MAPRE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415395 Transient overexpression lysate of microtubule-associated protein, RP/EB family, member 2 (MAPRE2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428369 Transient overexpression lysate of microtubule-associated protein, RP/EB family, member 2 (MAPRE2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY428370 Transient overexpression lysate of microtubule-associated protein, RP/EB family, member 2 (MAPRE2), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP300259 Recombinant protein of human microtubule-associated protein, RP/EB family, member 2 (MAPRE2), transcript variant 1, 20 µg 20 ug
$737.00
TP326779 Purified recombinant protein of Homo sapiens microtubule-associated protein, RP/EB family, member 2 (MAPRE2), transcript variant 3, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products