EB2 (MAPRE2) (NM_001143827) Human Mass Spec Standard

SKU
PH326779
MAPRE2 MS Standard C13 and N15-labeled recombinant protein (NP_001137299)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226779]
Predicted MW 35.6 kDa
Protein Sequence
Protein Sequence
>RC226779 representing NM_001143827
Red=Cloning site Green=Tags(s)

MKQNRDQKCPVSQRNSSFQQPGRKPGCSSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLC
SGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQ
WFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPS
SAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQR
LMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001137299
RefSeq ORF 945
Synonyms CSCSC2; EB1; EB2; RP1
Locus ID 10982
UniProt ID Q15555
Cytogenetics 18q12.1-q12.2
Summary The protein encoded by this gene shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family. This protein is a microtubule-associated protein that is necessary for spindle symmetry during mitosis. It is thought to play a role in the tumorigenesis of colorectal cancers and the proliferative control of normal cells. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2012]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:EB2 (MAPRE2) (NM_001143827) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300259 MAPRE2 MS Standard C13 and N15-labeled recombinant protein (NP_055083) 10 ug
$3,255.00
LC415395 MAPRE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428369 MAPRE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428370 MAPRE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415395 Transient overexpression lysate of microtubule-associated protein, RP/EB family, member 2 (MAPRE2), transcript variant 1 100 ug
$436.00
LY428369 Transient overexpression lysate of microtubule-associated protein, RP/EB family, member 2 (MAPRE2), transcript variant 2 100 ug
$436.00
LY428370 Transient overexpression lysate of microtubule-associated protein, RP/EB family, member 2 (MAPRE2), transcript variant 3 100 ug
$436.00
TP300259 Recombinant protein of human microtubule-associated protein, RP/EB family, member 2 (MAPRE2), transcript variant 1, 20 µg 20 ug
$737.00
TP326779 Purified recombinant protein of Homo sapiens microtubule-associated protein, RP/EB family, member 2 (MAPRE2), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.