EB2 (MAPRE2) (NM_001143827) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC226779] |
Predicted MW | 35.6 kDa |
Protein Sequence |
Protein Sequence
>RC226779 representing NM_001143827
Red=Cloning site Green=Tags(s) MKQNRDQKCPVSQRNSSFQQPGRKPGCSSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLC SGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQ WFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPS SAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQR LMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001137299 |
RefSeq ORF | 945 |
Synonyms | CSCSC2; EB1; EB2; RP1 |
Locus ID | 10982 |
UniProt ID | Q15555 |
Cytogenetics | 18q12.1-q12.2 |
Summary | The protein encoded by this gene shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family. This protein is a microtubule-associated protein that is necessary for spindle symmetry during mitosis. It is thought to play a role in the tumorigenesis of colorectal cancers and the proliferative control of normal cells. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2012] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300259 | MAPRE2 MS Standard C13 and N15-labeled recombinant protein (NP_055083) | 10 ug |
$3,255.00
|
|
LC415395 | MAPRE2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428369 | MAPRE2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428370 | MAPRE2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY415395 | Transient overexpression lysate of microtubule-associated protein, RP/EB family, member 2 (MAPRE2), transcript variant 1 | 100 ug |
$436.00
|
|
LY428369 | Transient overexpression lysate of microtubule-associated protein, RP/EB family, member 2 (MAPRE2), transcript variant 2 | 100 ug |
$436.00
|
|
LY428370 | Transient overexpression lysate of microtubule-associated protein, RP/EB family, member 2 (MAPRE2), transcript variant 3 | 100 ug |
$436.00
|
|
TP300259 | Recombinant protein of human microtubule-associated protein, RP/EB family, member 2 (MAPRE2), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP326779 | Purified recombinant protein of Homo sapiens microtubule-associated protein, RP/EB family, member 2 (MAPRE2), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.