OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CLEC4E (NM_014358) Human Mass Spec Standard

Be the first to review this product
SKU
PH300244
CLEC4E MS Standard C13 and N15-labeled recombinant protein (NP_055173)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505101 CLEC4E mouse monoclonal antibody, clone OTI2A8 (formerly 2A8) 100 ul
$447.00
LY415339 Transient overexpression lysate of C-type lectin domain family 4, member E (CLEC4E) (as WB positive control) 100 ug
$436.00

Other products for "CLEC4E or NM_014358"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200244
Predicted MW 25.1 kDa
Protein Sequence
Protein Sequence
>RC200244 protein sequence
Red=Cloning site Green=Tags(s)

MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYN
YGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIG
LSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGI
NPLNKGKSL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055173
RefSeq Size 2158
RefSeq ORF 657
Synonyms CLECSF9; MINCLE
Locus ID 26253
UniProt ID Q9ULY5
Cytogenetics 12p13.31
Summary This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CLEC4E" proteins (4)
SKU Description Size Price
LC415339 Lyophilized CLEC4E HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415339 Transient overexpression lysate of C-type lectin domain family 4, member E (CLEC4E) (as WB positive control) 100 ug
$436.00
TP300244 Recombinant protein of human C-type lectin domain family 4, member E (CLEC4E), 20 µg 20 ug
$737.00
TP720695 Purified recombinant protein of Human C-type lectin domain family 4, member E (CLEC4E) 10 ug
$275.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products