CLEC4E (NM_014358) Human Tagged ORF Clone

SKU
RC200244
CLEC4E (Myc-DDK-tagged)-Human C-type lectin domain family 4, member E (CLEC4E)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CLEC4E
Synonyms CLECSF9; MINCLE
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200244 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATTCATCTAAATCATCTGAAACACAATGCACAGAGAGAGGATGCTTCTCTTCCCAAATGTTCTTAT
GGACTGTTGCTGGGATCCCCATCCTATTTCTCAGTGCCTGTTTCATCACCAGATGTGTTGTGACATTTCG
CATCTTTCAAACCTGTGATGAGAAAAAGTTTCAGCTACCTGAGAATTTCACAGAGCTCTCCTGCTACAAT
TATGGATCAGGTTCAGTCAAGAATTGTTGTCCATTGAACTGGGAATATTTTCAATCCAGCTGCTACTTCT
TTTCTACTGACACCATTTCCTGGGCGTTAAGTTTAAAGAACTGCTCAGCCATGGGGGCTCACCTGGTGGT
TATCAACTCACAGGAGGAGCAGGAATTCCTTTCCTACAAGAAACCTAAAATGAGAGAGTTTTTTATTGGA
CTGTCAGACCAGGTTGTCGAGGGTCAGTGGCAATGGGTGGACGGCACACCTTTGACAAAGTCTCTGAGCT
TCTGGGATGTAGGGGAGCCCAACAACATAGCTACCCTGGAGGACTGTGCCACCATGAGAGACTCTTCAAA
CCCAAGGCAAAATTGGAATGATGTAACCTGTTTCCTCAATTATTTTCGGATTTGTGAAATGGTAGGAATA
AATCCTTTGAACAAAGGAAAATCTCTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200244 protein sequence
Red=Cloning site Green=Tags(s)

MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYN
YGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIG
LSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGI
NPLNKGKSL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014358
ORF Size 657 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014358.4
RefSeq Size 2158 bp
RefSeq ORF 660 bp
Locus ID 26253
UniProt ID Q9ULY5
Cytogenetics 12p13.31
Domains CLECT
Protein Families Druggable Genome, Transmembrane
MW 25.1 kDa
Summary This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CLEC4E (NM_014358) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200244L1 Lenti ORF clone of Human C-type lectin domain family 4, member E (CLEC4E), Myc-DDK-tagged 10 ug
$600.00
RC200244L2 Lenti ORF clone of Human C-type lectin domain family 4, member E (CLEC4E), mGFP tagged 10 ug
$600.00
RC200244L3 Lenti ORF clone of Human C-type lectin domain family 4, member E (CLEC4E), Myc-DDK-tagged 10 ug
$600.00
RC200244L4 Lenti ORF clone of Human C-type lectin domain family 4, member E (CLEC4E), mGFP tagged 10 ug
$600.00
RG200244 CLEC4E (tGFP-tagged) - Human C-type lectin domain family 4, member E (CLEC4E) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC115060 CLEC4E (untagged)-Human C-type lectin domain family 4, member E (CLEC4E) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.