OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ceramide synthase 2 (CERS2) (NM_022075) Human Mass Spec Standard

Be the first to review this product
SKU
PH300145
LASS2 MS Standard C13 and N15-labeled recombinant protein (NP_071358)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA809918 CERS2 mouse monoclonal antibody,clone OTI3D9 100 ul
$447.00
LY411798 Transient overexpression lysate of LAG1 homolog, ceramide synthase 2 (LASS2), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "Ceramide synthase 2 or NM_022075"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200145
Predicted MW 44.9 kDa
Protein Sequence
Protein Sequence
>RC200145 protein sequence
Red=Cloning site Green=Tags(s)

MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIVRYFFELYVATPLAALLNI
KEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRRRRNQDRPSLLKKFREASWRF
TFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQYWYYMIELSFYWSLLFSIASDVKRKDFKEQI
IHHVATIILISFSWFANYIRAGTLIMALHDSSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVIL
PFWILHCTLVYPLELYPAFFGYYFFNSMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSE
GEEAAAGGGAKSRPLANGHPILNNNHRKND

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071358
RefSeq Size 2504
RefSeq ORF 1140
Synonyms L3; LASS2; SP260; TMSG1
Locus ID 29956
UniProt ID Q96G23
Cytogenetics 1q21.3
Summary This gene encodes a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth. Alternatively spliced transcript variants encoding the same protein have been described. provided by RefSeq, Jul 2008
Protein Families Transcription Factors, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Ceramide synthase 2" proteins (7)
SKU Description Size Price
PH315300 LASS2 MS Standard C13 and N15-labeled recombinant protein (NP_859530) 10 ug
$3,360.00
LC405622 Lyophilized CERS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC411798 Lyophilized CERS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405622 Transient overexpression lysate of LAG1 homolog, ceramide synthase 2 (LASS2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY411798 Transient overexpression lysate of LAG1 homolog, ceramide synthase 2 (LASS2), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP300145 Purified recombinant protein of Homo sapiens LAG1 homolog, ceramide synthase 2 (LASS2), transcript variant 2, 20 µg 20 ug
$737.00
TP315300 Recombinant protein of human LAG1 homolog, ceramide synthase 2 (LASS2), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products