Ceramide synthase 2 (CERS2) (NM_022075) Human Recombinant Protein

SKU
TP300145
Purified recombinant protein of Homo sapiens LAG1 homolog, ceramide synthase 2 (LASS2), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200145 protein sequence
Red=Cloning site Green=Tags(s)

MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIVRYFFELYVATPLAALLNI
KEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRRRRNQDRPSLLKKFREASWRF
TFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQYWYYMIELSFYWSLLFSIASDVKRKDFKEQI
IHHVATIILISFSWFANYIRAGTLIMALHDSSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVIL
PFWILHCTLVYPLELYPAFFGYYFFNSMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSE
GEEAAAGGGAKSRPLANGHPILNNNHRKND

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 44.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_071358
Locus ID 29956
UniProt ID Q96G23
Cytogenetics 1q21.3
RefSeq Size 2504
RefSeq ORF 1140
Synonyms L3; LASS2; SP260; TMSG1
Summary This gene encodes a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008]
Protein Families Transcription Factors, Transmembrane
Write Your Own Review
You're reviewing:Ceramide synthase 2 (CERS2) (NM_022075) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300145 LASS2 MS Standard C13 and N15-labeled recombinant protein (NP_071358) 10 ug
$3,255.00
PH315300 LASS2 MS Standard C13 and N15-labeled recombinant protein (NP_859530) 10 ug
$3,255.00
LC405622 CERS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC411798 CERS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405622 Transient overexpression lysate of LAG1 homolog, ceramide synthase 2 (LASS2), transcript variant 1 100 ug
$436.00
LY411798 Transient overexpression lysate of LAG1 homolog, ceramide synthase 2 (LASS2), transcript variant 2 100 ug
$436.00
TP315300 Recombinant protein of human LAG1 homolog, ceramide synthase 2 (LASS2), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.