Ceramide synthase 2 (CERS2) Rabbit Polyclonal Antibody

SKU TA330626

Rabbit Polyclonal Anti-LASS2 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LASS2 antibody: synthetic peptide directed towards the N terminal of human LASS2. Synthetic peptide located within the following region: EKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRRR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: ceramide synthase 2
• Database Link:
  NP_071358
  Q96G23
• Background: LASS2 is a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth. This gene encodes a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth. Alternatively spliced transcript variants encoding the same protein have been described.
• Synonyms: L3; LASS2; SP260; TMSG1
• Note: Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Horse: 92%; Bovine: 86%

Reference Data

• Protein Families: Transcription Factors, Transmembrane