Ceramide synthase 2 (CERS2) (NM_181746) Human Mass Spec Standard

SKU
PH315300
LASS2 MS Standard C13 and N15-labeled recombinant protein (NP_859530)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215300]
Predicted MW 44.9 kDa
Protein Sequence
Protein Sequence
>RC215300 protein sequence
Red=Cloning site Green=Tags(s)

MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIVRYFFELYVATPLAALLNI
KEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRRRRNQDRPSLLKKFREASWRF
TFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQYWYYMIELSFYWSLLFSIASDVKRKDFKEQI
IHHVATIILISFSWFANYIRAGTLIMALHDSSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVIL
PFWILHCTLVYPLELYPAFFGYYFFNSMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSE
GEEAAAGGGAKSRPLANGHPILNNNHRKND

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_859530
RefSeq Size 2544
RefSeq ORF 1140
Synonyms L3; LASS2; SP260; TMSG1
Locus ID 29956
UniProt ID Q96G23
Cytogenetics 1q21.3
Summary This gene encodes a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008]
Protein Families Transcription Factors, Transmembrane
Write Your Own Review
You're reviewing:Ceramide synthase 2 (CERS2) (NM_181746) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300145 LASS2 MS Standard C13 and N15-labeled recombinant protein (NP_071358) 10 ug
$3,255.00
LC405622 CERS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC411798 CERS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405622 Transient overexpression lysate of LAG1 homolog, ceramide synthase 2 (LASS2), transcript variant 1 100 ug
$436.00
LY411798 Transient overexpression lysate of LAG1 homolog, ceramide synthase 2 (LASS2), transcript variant 2 100 ug
$436.00
TP300145 Purified recombinant protein of Homo sapiens LAG1 homolog, ceramide synthase 2 (LASS2), transcript variant 2, 20 µg 20 ug
$737.00
TP315300 Recombinant protein of human LAG1 homolog, ceramide synthase 2 (LASS2), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.