OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

THUMPD3 (NM_015453) Human Mass Spec Standard

Be the first to review this product
SKU
PH300121
THUMPD3 MS Standard C13 and N15-labeled recombinant protein (NP_056268)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA370228 THUMPD3 rabbit polyclonal antibody
100 ul
$310.00
LY414534 Transient overexpression lysate of THUMP domain containing 3 (THUMPD3), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "THUMPD3 or NM_015453"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200121
Predicted MW 57 kDa
Protein Sequence
Protein Sequence
>RC200121 protein sequence
Red=Cloning site Green=Tags(s)

MCDIEEATNQLLDVNLHENQKSVQVTESDLGSESELLVTIGATVPTGFEQTAADEVREKLGSSCKISRDR
GKIYFVISVESLAQVHCLRSVDNLFVVVQEFQDYQFKQTKEEVLKDFEDLAGKLPWSNPLKVWKINASFK
KKKAKRKKINQNSSKEKINNGQEVKIDQRNVKKEFTSHALDSHILDYYENPAIKEDVSTLIGDDLASCKD
ETDESSKEETEPQVLKFRVTCNRAGEKHCFTSNEAARDFGGAVQDYFKWKADMTNFDVEVLLNIHDNEVI
VGIALTEESLHRRNITHFGPTTLRSTLAYGMLRLCDPLPYDIIVDPMCGTGAIPIEGATEWSDCFHIAGD
NNPLAVNRAANNIASLLTKSQIKEGKPSWGLPIDAVQWDICNLPLRTGSVDIIVTDLPFGKRMGSKKRNW
NLYPACLREMSRVCTPTTGRAVLLTQDTKCFTKALSGMRHVWRKVDTVWVNVGGLRAAVYVLIRTPQAFV
HPSEQDGERGTLWQCKE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056268
RefSeq Size 3980
RefSeq ORF 1521
Locus ID 25917
UniProt ID Q9BV44
Cytogenetics 3p25.3
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "THUMPD3" proteins (7)
SKU Description Size Price
PH325871 THUMPD3 MS Standard C13 and N15-labeled recombinant protein (NP_001107564) 10 ug
$3,360.00
LC414534 Lyophilized THUMPD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426446 Lyophilized THUMPD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414534 Transient overexpression lysate of THUMP domain containing 3 (THUMPD3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426446 Transient overexpression lysate of THUMP domain containing 3 (THUMPD3), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP300121 Recombinant protein of human THUMP domain containing 3 (THUMPD3), transcript variant 1, 20 µg 20 ug
$867.00
TP325871 Recombinant protein of human THUMP domain containing 3 (THUMPD3), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products