THUMPD3 (NM_015453) Human Recombinant Protein

SKU
TP300121
Recombinant protein of human THUMP domain containing 3 (THUMPD3), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200121 protein sequence
Red=Cloning site Green=Tags(s)

MCDIEEATNQLLDVNLHENQKSVQVTESDLGSESELLVTIGATVPTGFEQTAADEVREKLGSSCKISRDR
GKIYFVISVESLAQVHCLRSVDNLFVVVQEFQDYQFKQTKEEVLKDFEDLAGKLPWSNPLKVWKINASFK
KKKAKRKKINQNSSKEKINNGQEVKIDQRNVKKEFTSHALDSHILDYYENPAIKEDVSTLIGDDLASCKD
ETDESSKEETEPQVLKFRVTCNRAGEKHCFTSNEAARDFGGAVQDYFKWKADMTNFDVEVLLNIHDNEVI
VGIALTEESLHRRNITHFGPTTLRSTLAYGMLRLCDPLPYDIIVDPMCGTGAIPIEGATEWSDCFHIAGD
NNPLAVNRAANNIASLLTKSQIKEGKPSWGLPIDAVQWDICNLPLRTGSVDIIVTDLPFGKRMGSKKRNW
NLYPACLREMSRVCTPTTGRAVLLTQDTKCFTKALSGMRHVWRKVDTVWVNVGGLRAAVYVLIRTPQAFV
HPSEQDGERGTLWQCKE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 56.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_056268
Locus ID 25917
UniProt ID Q9BV44
Cytogenetics 3p25.3
RefSeq Size 3980
RefSeq ORF 1521
Write Your Own Review
You're reviewing:THUMPD3 (NM_015453) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300121 THUMPD3 MS Standard C13 and N15-labeled recombinant protein (NP_056268) 10 ug
$3,255.00
PH325871 THUMPD3 MS Standard C13 and N15-labeled recombinant protein (NP_001107564) 10 ug
$3,255.00
LC414534 THUMPD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426446 THUMPD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414534 Transient overexpression lysate of THUMP domain containing 3 (THUMPD3), transcript variant 1 100 ug
$436.00
LY426446 Transient overexpression lysate of THUMP domain containing 3 (THUMPD3), transcript variant 2 100 ug
$436.00
TP325871 Recombinant protein of human THUMP domain containing 3 (THUMPD3), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.