THUMPD3 (NM_015453) Human Mass Spec Standard

SKU
PH300121
THUMPD3 MS Standard C13 and N15-labeled recombinant protein (NP_056268)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200121]
Predicted MW 57 kDa
Protein Sequence
Protein Sequence
>RC200121 protein sequence
Red=Cloning site Green=Tags(s)

MCDIEEATNQLLDVNLHENQKSVQVTESDLGSESELLVTIGATVPTGFEQTAADEVREKLGSSCKISRDR
GKIYFVISVESLAQVHCLRSVDNLFVVVQEFQDYQFKQTKEEVLKDFEDLAGKLPWSNPLKVWKINASFK
KKKAKRKKINQNSSKEKINNGQEVKIDQRNVKKEFTSHALDSHILDYYENPAIKEDVSTLIGDDLASCKD
ETDESSKEETEPQVLKFRVTCNRAGEKHCFTSNEAARDFGGAVQDYFKWKADMTNFDVEVLLNIHDNEVI
VGIALTEESLHRRNITHFGPTTLRSTLAYGMLRLCDPLPYDIIVDPMCGTGAIPIEGATEWSDCFHIAGD
NNPLAVNRAANNIASLLTKSQIKEGKPSWGLPIDAVQWDICNLPLRTGSVDIIVTDLPFGKRMGSKKRNW
NLYPACLREMSRVCTPTTGRAVLLTQDTKCFTKALSGMRHVWRKVDTVWVNVGGLRAAVYVLIRTPQAFV
HPSEQDGERGTLWQCKE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056268
RefSeq Size 3980
RefSeq ORF 1521
Locus ID 25917
UniProt ID Q9BV44
Cytogenetics 3p25.3
Write Your Own Review
You're reviewing:THUMPD3 (NM_015453) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH325871 THUMPD3 MS Standard C13 and N15-labeled recombinant protein (NP_001107564) 10 ug
$3,255.00
LC414534 THUMPD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426446 THUMPD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414534 Transient overexpression lysate of THUMP domain containing 3 (THUMPD3), transcript variant 1 100 ug
$436.00
LY426446 Transient overexpression lysate of THUMP domain containing 3 (THUMPD3), transcript variant 2 100 ug
$436.00
TP300121 Recombinant protein of human THUMP domain containing 3 (THUMPD3), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP325871 Recombinant protein of human THUMP domain containing 3 (THUMPD3), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.