OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TMX2 (NM_015959) Human Mass Spec Standard

Be the first to review this product
SKU
PH300032
TMX2 MS Standard C13 and N15-labeled recombinant protein (NP_057043)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA382633 TMX2 Rabbit polyclonal Antibody
100 ul
$410.00
LY402476 Transient overexpression lysate of thioredoxin-related transmembrane protein 2 (TMX2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "TMX2 or NM_015959"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200032
Predicted MW 34 kDa
Protein Sequence
Protein Sequence
>RC200032 protein sequence
Red=Cloning site Green=Tags(s)

MAVLAPLIALVYSVPRLSRWLAQPYYLLSALLSAAFLLVRKLPPLCHGLPTQREDGNPCDFDWREVEILM
FLSAIVMMKNRRSITVEQHIGNIFMFSKVANTILFFRLDIRMGLLYITLCIVFLMTCKPPLYMGPEYIKY
FNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVST
SPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPV
ASTPTTVSDGENKKDK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057043
RefSeq Size 1741
RefSeq ORF 888
Synonyms CGI-31; NEDMCMS; PDIA12; PIG26; TXNDC14
Locus ID 51075
UniProt ID Q9Y320
Cytogenetics 11q12.1
Summary This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, one transmembrane domain and a C-terminal ER-retention sequence. This protein is enriched on the mitochondria-associated-membrane of the ER via palmitoylation of two of its cytosolically exposed cysteines. provided by RefSeq, Jan 2017
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TMX2" proteins (6)
SKU Description Size Price
LC402476 Lyophilized TMX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428471 Lyophilized TMX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402476 Transient overexpression lysate of thioredoxin-related transmembrane protein 2 (TMX2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428471 Transient overexpression lysate of thioredoxin-related transmembrane protein 2 (TMX2), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP300032 Recombinant protein of human thioredoxin-related transmembrane protein 2 (TMX2), transcript variant 1, 20 µg 20 ug
$867.00
TP721162 Purified recombinant protein of Human thioredoxin-related transmembrane protein 2 (TMX2), transcript variant 1 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products