TMX2 (NM_015959) Human Tagged ORF Clone

SKU
RC200032
TMX2 (Myc-DDK-tagged)-Human thioredoxin-related transmembrane protein 2 (TMX2), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TMX2
Synonyms CGI-31; NEDMCMS; PDIA12; PIG26; TXNDC14
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200032 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGTCTTGGCACCTCTAATTGCTCTCGTGTATTCGGTGCCGCGACTTTCACGATGGCTCGCCCAAC
CTTACTACCTTCTGTCGGCCCTGCTCTCTGCTGCCTTCCTACTCGTGAGGAAACTGCCGCCGCTCTGCCA
CGGTCTGCCCACCCAACGCGAAGACGGTAACCCGTGTGACTTTGACTGGAGAGAAGTGGAGATCCTGATG
TTTCTCAGTGCCATTGTGATGATGAAGAACCGCAGATCCATCACTGTGGAGCAACATATAGGCAACATTT
TCATGTTTAGTAAAGTGGCCAACACAATTCTTTTCTTCCGCTTGGATATTCGCATGGGCCTACTTTACAT
CACACTCTGCATAGTGTTCCTGATGACGTGCAAACCCCCCCTATATATGGGCCCTGAGTATATCAAGTAC
TTCAATGATAAAACCATTGATGAGGAACTAGAACGGGACAAGAGGGTCACTTGGATTGTGGAGTTCTTTG
CCAATTGGTCTAATGACTGCCAATCATTTGCCCCTATCTATGCTGACCTCTCCCTTAAATACAACTGTAC
AGGGCTAAATTTTGGGAAGGTGGATGTTGGACGCTATACTGATGTTAGTACGCGGTACAAAGTGAGCACA
TCACCCCTCACCAAGCAACTCCCTACCCTGATCCTGTTCCAAGGTGGCAAGGAGGCAATGCGGCGGCCAC
AGATTGACAAGAAAGGACGGGCTGTCTCATGGACCTTCTCTGAGGAGAATGTGATCCGAGAATTTAACTT
AAATGAGCTATACCAGCGGGCCAAGAAACTATCAAAGGCTGGAGACAATATCCCTGAGGAGCAGCCTGTG
GCTTCAACCCCCACCACAGTGTCAGATGGGGAAAACAAGAAGGATAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200032 protein sequence
Red=Cloning site Green=Tags(s)

MAVLAPLIALVYSVPRLSRWLAQPYYLLSALLSAAFLLVRKLPPLCHGLPTQREDGNPCDFDWREVEILM
FLSAIVMMKNRRSITVEQHIGNIFMFSKVANTILFFRLDIRMGLLYITLCIVFLMTCKPPLYMGPEYIKY
FNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVST
SPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPV
ASTPTTVSDGENKKDK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_015959
ORF Size 888 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_015959.4
RefSeq Size 1741 bp
RefSeq ORF 891 bp
Locus ID 51075
UniProt ID Q9Y320
Cytogenetics 11q12.1
Protein Families Druggable Genome, Transmembrane
MW 34 kDa
Summary This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, one transmembrane domain and a C-terminal ER-retention sequence. This protein is enriched on the mitochondria-associated-membrane of the ER via palmitoylation of two of its cytosolically exposed cysteines. [provided by RefSeq, Jan 2017]
Write Your Own Review
You're reviewing:TMX2 (NM_015959) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200032L1 Lenti ORF clone of Human thioredoxin-related transmembrane protein 2 (TMX2), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC200032L2 Lenti ORF clone of Human thioredoxin-related transmembrane protein 2 (TMX2), transcript variant 1, mGFP tagged 10 ug
$600.00
RC200032L3 Lenti ORF clone of Human thioredoxin-related transmembrane protein 2 (TMX2), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC200032L4 Lenti ORF clone of Human thioredoxin-related transmembrane protein 2 (TMX2), transcript variant 1, mGFP tagged 10 ug
$600.00
RG200032 TMX2 (tGFP-tagged) - Human thioredoxin-related transmembrane protein 2 (TMX2), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC107853 TMX2 (untagged)-Human thioredoxin-related transmembrane protein 2 (TMX2), transcript variant 1 10 ug
$300.00
SC324454 TMX2 (untagged)-Human thioredoxin-related transmembrane protein 2 (TMX2), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.