OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

WFDC3 (NM_080614) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG222831
WFDC3 (tGFP-tagged) - Human WAP four-disulfide core domain 3 (WFDC3)
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$489.00 $500.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "WFDC3 or NM_080614"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol WFDC3
Synonyms dJ447F3.3; WAP14
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG222831 representing NM_080614
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGTTAAGCTGCCTCTTTCTTCTGAAGGCACTTCTTGCTCTTGGGTCTCTGGAATCCTGGATAACTG
CAGGAGAACATGCAAAAGAGGGAGAATGCCCTCCCCATAAGAACCCATGCAAAGAGCTGTGCCAGGGTGA
TGAATTGTGTCCGGCTGAACAGAAGTGCTGCACCACAGGCTGTGGTCGGATCTGCCGAGACATTCCTAAG
GGGAGGAAAAGAGATTGCCCTAGGGTTATTCGGAAACAATCCTGTTTGAAAAGGTGCATCACTGATGAGA
CATGTCCAGGTGTAAAGAAATGCTGCACGCTTGGCTGCAACAAGAGCTGTGTAGTCCCAATCTCTAAACA
GAAGCTGGCAGAGTTTGGTGGTGAATGTCCCGCTGACCCCCTTCCGTGTGAGGAGCTGTGTGATGGGGAT
GCATCCTGTCCCCAGGGGCATAAATGCTGCAGCACCGGCTGTGGCCGCACCTGCCTCGGAGACATTGAGG
GAGGGCGGGGCGGTGATTGTCCAAAAGTTCTGGTGGGCCTGTGCATTGTTGGCTGTGTGATGGATGAGAA
TTGTCAAGCTGGAGAAAAATGTTGCAAGTCAGGCTGTGGCCGCTTCTGTGTCCCACCAGTCCTGCCCCCA
AAACTGACCATGAACCCCAACTGGACTGTGAGGTCTGATTCCGAATTAGAGATCCCGGTGCCC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG222831 representing NM_080614
Red=Cloning site Green=Tags(s)

MMLSCLFLLKALLALGSLESWITAGEHAKEGECPPHKNPCKELCQGDELCPAEQKCCTTGCGRICRDIPK
GRKRDCPRVIRKQSCLKRCITDETCPGVKKCCTLGCNKSCVVPISKQKLAEFGGECPADPLPCEELCDGD
ASCPQGHKCCSTGCGRTCLGDIEGGRGGDCPKVLVGLCIVGCVMDENCQAGEKCCKSGCGRFCVPPVLPP
KLTMNPNWTVRSDSELEIPVP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_080614
ORF Size 693 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_080614.2
RefSeq Size 1000 bp
RefSeq ORF 696 bp
Locus ID 140686
UniProt ID Q8IUB2
Cytogenetics 20q13.12
Protein Families Secreted Protein
Summary This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. The encoded protein contains four WFDC domains. Most WFDC genes are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the telomeric cluster. Alternatively spliced transcript variants have been observed but their full-length nature has not been determined. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_080614" in other vectors (4)
SKU Description Size Price
RC222831 WFDC3 (Myc-DDK-tagged)-Human WAP four-disulfide core domain 3 (WFDC3) 10 ug
$300.00
RC222831L3 Lenti ORF clone of Human WAP four-disulfide core domain 3 (WFDC3), Myc-DDK-tagged 10 ug
$600.00
RC222831L4 Lenti ORF clone of Human WAP four-disulfide core domain 3 (WFDC3), mGFP tagged 10 ug
$600.00
SC305804 WFDC3 (untagged)-Human WAP four-disulfide core domain 3 (WFDC3) 10 ug
$300.00

Plasmid Map for RG222831

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG222831
Circular map for RG222831

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products