MAFG (NM_002359) Human Tagged ORF Clone

SKU
RG221486
MAFG (tGFP-tagged) - Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian) (MAFG), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MAFG
Synonyms hMAF
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG221486 representing NM_002359
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGACCCCCAATAAAGGAAACAAGGCCTTGAAGGTGAAGCGGGAGCCGGGTGAGAATGGCACCAGCC
TGACGGATGAGGAGCTGGTGACCATGTCGGTGCGGGAGCTGAACCAGCACCTGCGGGGCCTGTCCAAGGA
GGAGATCGTCCAGCTGAAGCAGCGCCGGCGCACGCTCAAGAACCGCGGCTACGCTGCCAGCTGCCGCGTG
AAGCGGGTGACGCAGAAGGAGGAGCTGGAGAAGCAGAAGGCGGAGCTGCAGCAGGAGGTGGAGAAGCTGG
CCTCAGAGAACGCCAGCATGAAGCTGGAGCTCGACGCGCTGCGCTCCAAGTACGAGGCGCTGCAGACCTT
CGCCCGGACGGTGGCCCGCAGCCCCGTGGCGCCAGCCCGGGGCCCCCTTGCCGCCGGCCTGGGGCCCCTC
GTCCCAGGCAAGGTGGCCGCCACCAGCGTCATCACAATAGTAAAGTCCAAGACGGATGCCCGATCG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG221486 representing NM_002359
Red=Cloning site Green=Tags(s)

MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLKNRGYAASCRV
KRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYEALQTFARTVARSPVAPARGPLAAGLGPL
VPGKVAATSVITIVKSKTDARS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002359
ORF Size 486 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002359.4
RefSeq Size 5043 bp
RefSeq ORF 489 bp
Locus ID 4097
UniProt ID O15525
Cytogenetics 17q25.3
Domains BRLZ, bZIP_Maf
Protein Families Druggable Genome, Transcription Factors
Summary Globin gene expression is regulated through nuclear factor erythroid-2 (NFE2) elements located in enhancer-like locus control regions positioned many kb upstream of alpha- and beta-gene clusters (summarized by Blank et al., 1997 [PubMed 9166829]). NFE2 DNA-binding activity consists of a heterodimer containing a ubiquitous small Maf protein (MafF, MIM 604877; MafG; or MafK, MIM 600197) and the tissue-restricted protein p45 NFE2 (MIM 601490). Both subunits are members of the activator protein-1-like superfamily of basic leucine zipper (bZIP) proteins (see MIM 165160).[supplied by OMIM, Mar 2010]
Write Your Own Review
You're reviewing:MAFG (NM_002359) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC221486 MAFG (Myc-DDK-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian) (MAFG), transcript variant 1 10 ug
$150.00
RC221486L1 Lenti ORF clone of Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian) (MAFG), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC221486L2 Lenti ORF clone of Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian) (MAFG), transcript variant 1, mGFP tagged 10 ug
$450.00
RC221486L3 Lenti ORF clone of Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian) (MAFG), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC221486L4 Lenti ORF clone of Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian) (MAFG), transcript variant 1, mGFP tagged 10 ug
$450.00
SC118695 MAFG (untagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian) (MAFG), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.