OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Persephin (PSPN) (NM_004158) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG219067
PSPN (tGFP-tagged) - Human persephin (PSPN)
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
  $425.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA322783 Anti-PSPN Rabbit Polyclonal Antibody
100 ul
$305.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Persephin or NM_004158"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Persephin
Synonyms PSP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG219067 representing NM_004158
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGTAGGGAAGTTCCTGCTGGGCTCCCTGCTGCTCCTGTCCCTGCAGCTGGGACAGGGCTGGGGCC
CCGATGCCCGTGGGGTTCCCGTGGCCGATGGAGAGTTCTCGTCTGAACAGGTGGCAAAGGCTGGAGGGAC
CTGGCTGGGCACCCACCGCCCCCTTGCCCGCCTGCGCCGAGCCCTGTCTGGTCCATGCCAGCTGTGGAGC
CTGACCCTGTCCGTGGCAGAGCTAGGCCTGGGCTACGCCTCAGAGGAGAAGGTCATCTTCCGCTACTGCG
CCGGCAGCTGCCCCCGTGGTGCCCGCACCCAGCATGGCCTGGCGCTGGCCCGGCTGCAGGGCCAGGGCCG
AGCCCACGGCGGGCCCTGCTGCCGGCCCACTCGCTACACCGACGTGGCCTTCCTCGATGACCGCCACCGC
TGGCAGCGGCTGCCCCAGCTCTCGGCGGCTGCCTGCGGCTGTGGTGGC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG219067 representing NM_004158
Red=Cloning site Green=Tags(s)

MAVGKFLLGSLLLLSLQLGQGWGPDARGVPVADGEFSSEQVAKAGGTWLGTHRPLARLRRALSGPCQLWS
LTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHR
WQRLPQLSAAACGCGG

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_004158
ORF Size 468 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004158.3
RefSeq Size 471 bp
RefSeq ORF 471 bp
Locus ID 5623
UniProt ID O60542
Cytogenetics 19p13.3
Protein Families Secreted Protein
Summary This gene encodes a secreted ligand of the GDNF (glial cell line-derived neurotrophic factor) subfamily and TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein signals through the RET receptor tyrosine kinase and a GPI-linked coreceptor, and promotes survival of neuronal populations. This protein may play a role in cell death, and nervous system development and function. Elevated expression of this gene has been observed in oral squamous cell carcinoma. provided by RefSeq, Aug 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_004158" in other vectors (6)
SKU Description Size Price
RC219067 PSPN (Myc-DDK-tagged)-Human persephin (PSPN) 10 ug
$225.00
RC219067L1 Lenti ORF clone of Human persephin (PSPN), Myc-DDK-tagged 10 ug
$525.00
RC219067L2 Lenti ORF clone of Human persephin (PSPN), mGFP tagged 10 ug
$525.00
RC219067L3 Lenti ORF clone of Human persephin (PSPN), Myc-DDK-tagged 10 ug
$525.00
RC219067L4 Lenti ORF clone of Human persephin (PSPN), mGFP tagged 10 ug
$525.00
SC303442 PSPN (untagged)-Human persephin (PSPN) 10 ug
$150.00

Plasmid Map for RG219067

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG219067
Circular map for RG219067

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products