OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ODAPH (NM_178497) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG218037
C4orf26 (tGFP-tagged) - Human chromosome 4 open reading frame 26 (C4orf26), transcript variant 2
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $489.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA334793 Rabbit Polyclonal Anti-C4orf26 Antibody
100 ul
$585.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "ODAPH or NM_178497"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ODAPH
Synonyms AI2A4; C4orf26
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG218037 representing NM_178497
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCGCAGACACTGCTTCTCCTACTGGTTACTGGTATGCTGGTTGGTGGTAACTGTGGCAGAAGGAC
AAGAAGAGGTATTTACGCCTCCTGGAGATTCACAAAATAATGCGGACGCTACCGACTGCCAGATCTTTAC
ACTCACCCCTCCACCTGCCCCGAGGAGTCCGGTCACAAGGGCCCAGCCCATCACAAAGACACCCAGGTGT
CCCTTCCATTTTTTTCCACGAAGGCCCAGAATCCATTTTAGGTTTCCAAACAGACCTTTCGTCCCTTCAA
GGTGTAACCACCGTTTTCCATTCCAGCCATTTTATTGGCCACACCGTTACCTTACTTATAGGTATTTCCC
CAGAAGAAGACTCCAGAGAGGAAGCTCATCTGAGGAAAGC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG218037 representing NM_178497
Red=Cloning site Green=Tags(s)

MARRHCFSYWLLVCWLVVTVAEGQEEVFTPPGDSQNNADATDCQIFTLTPPPAPRSPVTRAQPITKTPRC
PFHFFPRRPRIHFRFPNRPFVPSRCNHRFPFQPFYWPHRYLTYRYFPRRRLQRGSSSEES

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_178497
ORF Size 390 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_178497.5
RefSeq Size 744 bp
RefSeq ORF 393 bp
Locus ID 152816
UniProt ID Q17RF5
Cytogenetics 4q21.1
Summary Dental enamel forms the outer cap of teeth and is the hardest substance found in vertebrates. This gene is thought to encode an extracellular matrix acidic phosphoprotein that has a function in enamel mineralization during amelogenesis. Mutations in this gene are associated with recessive hypomineralized amelogenesis imperfecta. provided by RefSeq, Oct 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_178497" in other vectors (4)
SKU Description Size Price
RC218037 C4orf26 (Myc-DDK-tagged)-Human chromosome 4 open reading frame 26 (C4orf26), transcript variant 2 10 ug
$150.00
RC218037L3 Lenti ORF clone of Human chromosome 4 open reading frame 26 (C4orf26), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC218037L4 Lenti ORF clone of Human chromosome 4 open reading frame 26 (C4orf26), transcript variant 2, mGFP tagged 10 ug
$450.00
SC307196 C4orf26 (untagged)-Human chromosome 4 open reading frame 26 (C4orf26), transcript variant 2 10 ug
$165.00

Plasmid Map for RG218037

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG218037
Circular map for RG218037

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products