OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RD3 (NM_183059) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG209596
RD3 (tGFP-tagged) - Human retinal degeneration 3 (RD3), transcript variant 1
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$489.00 $500.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA333379 Rabbit Polyclonal Anti-RD3 Antibody
100 ul
$585.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "RD3 or NM_183059"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RD3
Synonyms C1orf36; LCA12
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG209596 representing NM_183059
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTCTCATCTCATGGCTTCGGTGGAACGAGGCCCCATCCCGGCTGTCCACCAGGAGCCCTGCTGAGA
TGGTGCTGGAGACGCTTATGATGGAGCTGACGGGGCAGATGCGAGAGGCTGAGAGGCAGCAGCGGGAGCG
CAGCAATGCGGTCAGAAAGGTCTGCACCGGTGTGGACTACAGCTGGCTGGCCAGCACACCCCGGTCCACC
TATGACCTCAGCCCCATTGAGCGGTTGCAGCTGGAAGATGTCTGCGTTAAGATCCACCCATCCTATTGTG
GGCCTGCTATCCTCAGGTTCCGGCAGCTGCTGGCGGAGCAGGAGCCCGAGGTGCAGGAGGTGTCCCAGCT
CTTCCGCTCGGTGCTGCAGGAGGTCCTGGAGAGGATGAAGCAGGAAGAGGAGGCCCACAAGCTGACGCGC
CAGTGGAGCCTGCGGCCCCGCGGCAGCCTGGCCACCTTCAAGACCCGCGCGCGCATCTCGCCCTTCGCCA
GCGACATCAGGACCATCTCCGAGGACGTGGAGCGGGACACACCGCCGCCACTGCGGTCCTGGAGCATGCC
CGAATTCCGGGCGCCCAAAGCCGAC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG209596 representing NM_183059
Red=Cloning site Green=Tags(s)

MSLISWLRWNEAPSRLSTRSPAEMVLETLMMELTGQMREAERQQRERSNAVRKVCTGVDYSWLASTPRST
YDLSPIERLQLEDVCVKIHPSYCGPAILRFRQLLAEQEPEVQEVSQLFRSVLQEVLERMKQEEEAHKLTR
QWSLRPRGSLATFKTRARISPFASDIRTISEDVERDTPPPLRSWSMPEFRAPKAD

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_183059
ORF Size 585 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_183059.3
RefSeq Size 3351 bp
RefSeq ORF 588 bp
Locus ID 343035
UniProt ID Q7Z3Z2
Cytogenetics 1q32.3
Summary This gene encodes a retinal protein that is associated with promyelocytic leukemia-gene product (PML) bodies in the nucleus. Mutations in this gene cause Leber congenital amaurosis type 12, a disease that results in retinal degeneration. Alternative splicing results in multiple transcript variants. provided by RefSeq, Sep 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_183059" in other vectors (6)
SKU Description Size Price
RC209596 RD3 (Myc-DDK-tagged)-Human retinal degeneration 3 (RD3), transcript variant 1 10 ug
$300.00
RC209596L1 Lenti ORF clone of Human retinal degeneration 3 (RD3), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC209596L2 Lenti ORF clone of Human retinal degeneration 3 (RD3), transcript variant 1, mGFP tagged 10 ug
$600.00
RC209596L3 Lenti ORF clone of Human retinal degeneration 3 (RD3), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC209596L4 Lenti ORF clone of Human retinal degeneration 3 (RD3), transcript variant 1, mGFP tagged 10 ug
$600.00
SC125750 RD3 (untagged)-Human retinal degeneration 3 (RD3), transcript variant 1 10 ug
$300.00

Plasmid Map for RG209596

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG209596
Circular map for RG209596

file-alt Citations

Retinal Degeneration Protein 3 (RD3) in normal human tissues: Novel insights
Aravindan, Somasundaram, Kam et al
Sci Rep (2017) 7 (1), 13154 DOI: 10.1038/s41598-017-13337-9
AI Summary: OriGene products contributed to this study by providing the Human retinal degeneration 3 (RD3) plasmid (transcript variant 1) and TurboFectin 8.0 reagent, which were used for RD3 expression and DNA transfection experiments to investigate RD3 localization and function in human tissues.
Snippet: RD3 plasmid preparation and DNA transfection was performed as described in our earlier studies 8 . Expression of RD3 (Human retinal degeneration 3, transcript variant 1, Origene) was conducted with TurboFectin 8.0 reagent (Origene). … RD3 plasmid preparation and DNA transfection was performed as described in our earlier studies 8 . Expression of RD3 (Human retinal degeneration 3, transcript variant 1, Origene) was conducted with TurboFectin 8.0 reagent (Origene). …
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products