LYPD1 (NM_144586) Human Tagged ORF Clone

SKU
RG205703
LYPD1 (tGFP-tagged) - Human LY6/PLAUR domain containing 1 (LYPD1), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Target Symbol LYPD1
Synonyms LYPDC1; PHTS
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG205703 representing NM_144586
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGGTCCTAGGCATCGCGGCAACTTTTTGCGGATTGTTCTTGCTTCCAGGCTTTGCGCTGCAAATCC
AGTGCTACCAGTGTGAAGAATTCCAGCTGAACAACGACTGCTCCTCCCCCGAGTTCATTGTGAATTGCAC
GGTGAACGTTCAAGACATGTGTCAGAAAGAAGTGATGGAGCAAAGTGCCGGGATCATGTACCGCAAGTCC
TGTGCATCATCAGCGGCCTGTCTCATCGCCTCTGCCGGGTACCAGTCCTTCTGCTCCCCAGGGAAACTGA
ACTCAGTTTGCATCAGCTGCTGCAACACCCCTCTTTGTAACGGGCCAAGGCCCAAGAAAAGGGGAAGTTC
TGCCTCGGCCCTCAGGCCAGGGCTCCGCACCACCATCCTGTTCCTCAAATTAGCCCTCTTCTCGGCACAC
TGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG205703 representing NM_144586
Red=Cloning site Green=Tags(s)

MWVLGIAATFCGLFLLPGFALQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKS
CASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSSASALRPGLRTTILFLKLALFSAH
C

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_144586
ORF Size 423 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_144586.7
RefSeq Size 2683 bp
RefSeq ORF 426 bp
Locus ID 116372
UniProt ID Q8N2G4
Cytogenetics 2q21.2
Protein Families Druggable Genome, Transmembrane
Summary Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro increases receptor desensitization and decreases affinity for ACh of alpha-4:beta-2-containing nAChRs. May play a role in the intracellular trafficking of alpha-4:beta-2 and alpha-7-containing nAChRs and may inhibit their expression at the cell surface. May be involved in the control of anxiety.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:LYPD1 (NM_144586) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205703 LYPD1 (Myc-DDK-tagged)-Human LY6/PLAUR domain containing 1 (LYPD1), transcript variant 1 10 ug
$150.00
RC205703L1 Lenti ORF clone of Human LY6/PLAUR domain containing 1 (LYPD1), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC205703L2 Lenti ORF clone of Human LY6/PLAUR domain containing 1 (LYPD1), transcript variant 1, mGFP tagged 10 ug
$450.00
RC205703L3 Lenti ORF clone of Human LY6/PLAUR domain containing 1 (LYPD1), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC205703L4 Lenti ORF clone of Human LY6/PLAUR domain containing 1 (LYPD1), transcript variant 1, mGFP tagged 10 ug
$450.00
SC120737 LYPD1 (untagged)-Human LY6/PLAUR domain containing 1 (LYPD1), transcript variant 1 10 ug
$150.00
SC320440 LYPD1 (untagged)-Human LY6/PLAUR domain containing 1 (LYPD1), transcript variant 1 10 ug
$150.00
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.