OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAB2B (NM_032846) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG205033
RAB2B (tGFP-tagged) - Human RAB2B, member RAS oncogene family (RAB2B), transcript variant 1
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$489.00 $500.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA307960 Rabbit Polyclonal antibody to RAB2B (RAB2B, member RAS oncogene family)
100 ul
$665.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "RAB2B or NM_032846"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RAB2B
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG205033 representing NM_032846
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTTATGCTTATCTCTTCAAGTATATCATCATCGGAGACACAGGTGTGGGGAAGTCATGTCTCCTCC
TGCAGTTTACAGATAAGCGGTTCCAGCCTGTCCACGACCTCACAATAGGTGTGGAGTTTGGAGCTCGTAT
GGTCAACATTGATGGAAAACAAATCAAACTGCAAATCTGGGATACGGCTGGGCAAGAATCCTTCCGTTCT
ATCACCCGTTCCTACTACAGGGGAGCAGCTGGAGCACTGCTGGTGTACGACATTACAAGGCGTGAAACCT
TCAACCACCTGACCTCATGGTTAGAGGATGCCCGGCAGCACTCTAGTTCCAACATGGTTATCATGCTCAT
TGGGAATAAGAGTGACCTAGAGTCCCGCAGGGATGTGAAGAGAGAAGAAGGAGAGGCCTTTGCTAGGGAG
CATGGACTTATATTCATGGAAACTTCAGCCAAAACAGCCTGCAATGTTGAAGAGGCCTTCATTAACACAG
CCAAAGAAATATATAGGAAGATCCAGCAGGGTTTATTTGATGTCCACAATGAGGCAAATGGCATCAAGAT
TGGGCCCCAACAGTCAATTTCAACATCAGTGGGACCCAGTGCCTCCCAGCGGAACTCTCGTGACATAGGG
TCCAACTCTGGCTGCTGC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG205033 representing NM_032846
Red=Cloning site Green=Tags(s)

MTYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQESFRS
ITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKREEGEAFARE
HGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLFDVHNEANGIKIGPQQSISTSVGPSASQRNSRDIG
SNSGCC

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_032846
ORF Size 648 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032846.4
RefSeq Size 2335 bp
RefSeq ORF 651 bp
Locus ID 84932
UniProt ID Q8WUD1
Cytogenetics 14q11.2
Domains RAB, RAN, ras, RAS, RHO
Protein Families Druggable Genome
Summary Members of the Rab protein family are nontransforming monomeric GTP-binding proteins of the Ras superfamily that contain 4 highly conserved regions involved in GTP binding and hydrolysis. Rab proteins are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking; see MIM 179508.supplied by OMIM, Apr 2006
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_032846" in other vectors (4)
SKU Description Size Price
RC205033 RAB2B (Myc-DDK-tagged)-Human RAB2B, member RAS oncogene family (RAB2B), transcript variant 1 10 ug
$300.00
RC205033L3 Lenti ORF clone of Human RAB2B, member RAS oncogene family (RAB2B), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC205033L4 Lenti ORF clone of Human RAB2B, member RAS oncogene family (RAB2B), transcript variant 1, mGFP tagged 10 ug
$600.00
SC103158 RAB2B (untagged)-Human RAB2B, member RAS oncogene family (RAB2B), transcript variant 1 10 ug
$300.00

Plasmid Map for RG205033

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG205033
Circular map for RG205033

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products