OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SFRS7 (SRSF7) (NM_001031684) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG204785
SRSF7 (tGFP-tagged) - Human serine/arginine-rich splicing factor 7 (SRSF7), transcript variant 1
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$489.00 $500.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA382021 SRSF7 Rabbit polyclonal Antibody
100 ul
$410.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "SFRS7 or NM_001031684"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SFRS7
Synonyms 9G8; AAG3; SFRS7
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG204785 representing NM_001031684
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGCGTTACGGGCGGTACGGAGGAGAAACCAAGGTGTATGTTGGTAACCTGGGAACTGGCGCTGGCA
AAGGAGAGTTAGAAAGGGCTTTCAGTTATTATGGTCCTTTAAGAACTGTATGGATTGCGAGAAATCCTCC
AGGATTTGCCTTTGTGGAATTCGAAGATCCTAGAGATGCAGAAGATGCAGTACGAGGACTGGATGGAAAG
GTGATTTGTGGCTCCCGAGTGAGGGTTGAACTATCGACAGGCATGCCTCGGAGATCACGTTTTGATAGAC
CACCTGCCCGACGTCCCTTTGATCCAAATGATAGATGCTATGAGTGTGGCGAAAAGGGACATTATGCTTA
TGATTGTCATCGTTACAGCCGGCGAAGAAGAAGCAGGTCACGGTCTAGATCACATTCTCGATCCAGAGGA
AGGCGATACTCTCGCTCACGCAGCAGGAGCAGGGGACGAAGGTCAAGGTCAGCATCTCCTCGACGATCAA
GATCTATCTCTCTTCGTAGATCAAGATCAGCTTCACTCAGAAGATCTAGGTCTGGTTCTATAAAAGGATC
GAGGTATTTCCAATCCCCGTCGAGGTCAAGATCAAGATCCAGGTCTATTTCACGACCAAGAAGCAGCCGA
TCAAAGTCCAGATCTCCATCTCCAAAAAGAAGTCGTTCCCCATCAGGAAGTCCTCGCAGAAGTGCAAGTC
CTGAAAGAATGGAC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204785 representing NM_001031684
Red=Cloning site Green=Tags(s)

MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGK
VICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRG
RRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSR
SKSRSPSPKRSRSPSGSPRRSASPERMD

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001031684
ORF Size 714 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001031684.3
RefSeq Size 2381 bp
RefSeq ORF 717 bp
Locus ID 6432
UniProt ID Q16629
Cytogenetics 2p22.1
Protein Pathways Spliceosome
Summary The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an N-terminal RNA recognition motif (RRM) for binding RNA and a C-terminal RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, May 2018
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001031684" in other vectors (6)
SKU Description Size Price
RC204785 SRSF7 (Myc-DDK-tagged)-Human serine/arginine-rich splicing factor 7 (SRSF7), transcript variant 1 10 ug
$300.00
RC204785L1 Lenti ORF clone of Human serine/arginine-rich splicing factor 7 (SRSF7), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC204785L2 Lenti ORF clone of Human serine/arginine-rich splicing factor 7 (SRSF7), transcript variant 1, mGFP tagged 10 ug
$600.00
RC204785L3 Lenti ORF clone of Human serine/arginine-rich splicing factor 7 (SRSF7), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC204785L4 Lenti ORF clone of Human serine/arginine-rich splicing factor 7 (SRSF7), transcript variant 1, mGFP tagged 10 ug
$600.00
SC302531 SRSF7 (untagged)-Human serine/arginine-rich splicing factor 7 (SRSF7), transcript variant 1 10 ug
$300.00

Plasmid Map for RG204785

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG204785
Circular map for RG204785

file-alt Citations

C9orf72 Dipeptide Repeats Impair the Assembly, Dynamics, and Function of Membrane-Less Organelles
Lee, Zhang, Kim et al
Cell (2016) 167 (3), 774-788.e17 DOI: 10.1016/j.cell.2016.10.002
AI Summary: OriGene products SRSF7-GFP (RG204785), SRSF2-GFP (RG209842), and DDX47-GFP (RG209448) were used as plasmids to study the interactions and effects of C9orf72 dipeptide repeats on proteins involved in membrane-less organelles.
Snippet: Plasmid: SRSF7-GFP, OriGene, RG204785 Plasmid: SRSF2-GFP, OriGene, RG209842 Plasmid: DDX47-GFP, OriGene, RG209448
Figure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products