OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CLEC2B (NM_005127) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG202700
CLEC2B (tGFP-tagged) - Human C-type lectin domain family 2, member B (CLEC2B)
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $489.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA322665 Anti-CLEC2B Rabbit Polyclonal Antibody
100 ul
$305.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "CLEC2B or NM_005127"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CLEC2B
Synonyms AICL; CLECSF2; HP10085; IFNRG1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG202700 representing NM_005127
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGACCAAACATAAAAAGTGTTTTATAATTGTTGGTGTTTTAATAACAACTAATATTATTACTCTGA
TAGTTAAACTAACTCGAGATTCTCAGAGTTTATGCCCCTATGATTGGATTGGTTTCCAAAACAAATGCTA
TTATTTCTCTAAAGAAGAAGGAGATTGGAATTCAAGTAAATACAACTGTTCCACTCAACATGCCGACCTA
ACTATAATTGACAACATAGAAGAAACGAATTTTCTTAGGCGGTATAAATGCAGTTCTGATCACTGGATTG
GACTGAAGATGGCAAAAAATCGAACAGGACAATGGGTAGATGGAGCTACATTTACCAAATCGTTTGGCAT
GAGAGGGAGTGAAGGATGTGCCTACCTCAGCGATGATGGTGCAGCAACAGCTAGATGTTACACCGAAAGA
AAATGGATTTGCAGGAAAAGAATACAC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG202700 representing NM_005127
Red=Cloning site Green=Tags(s)

MMTKHKKCFIIVGVLITTNIITLIVKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADL
TIIDNIEETNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTER
KWICRKRIH

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_005127
ORF Size 447 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005127.2, NP_005118.2
RefSeq Size 2052 bp
RefSeq ORF 450 bp
Locus ID 9976
UniProt ID Q92478
Cytogenetics 12p13.31
Protein Families Druggable Genome, Transmembrane
Summary This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell activation antigen. An alternative splice variant has been described but its full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_005127" in other vectors (6)
SKU Description Size Price
RC202700 CLEC2B (Myc-DDK-tagged)-Human C-type lectin domain family 2, member B (CLEC2B) 10 ug
$150.00
RC202700L1 Lenti ORF clone of Human C-type lectin domain family 2, member B (CLEC2B), Myc-DDK-tagged 10 ug
$450.00
RC202700L2 Lenti ORF clone of Human C-type lectin domain family 2, member B (CLEC2B), mGFP tagged 10 ug
$450.00
RC202700L3 Lenti ORF clone of Human C-type lectin domain family 2, member B (CLEC2B), Myc-DDK-tagged 10 ug
$450.00
RC202700L4 Lenti ORF clone of Human C-type lectin domain family 2, member B (CLEC2B), mGFP tagged 10 ug
$450.00
SC303588 CLEC2B (untagged)-Human C-type lectin domain family 2, member B (CLEC2B) 10 ug
$165.00

Plasmid Map for RG202700

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG202700
Circular map for RG202700

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products