OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ORMDL1 (NM_016467) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG202670
ORMDL1 (tGFP-tagged) - Human ORM1-like 1 (S. cerevisiae) (ORMDL1), transcript variant 1
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $489.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA320079 Rabbit Polyclonal ORMDL1 Antibody
100 ug
$640.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "ORMDL1 or NM_016467"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ORMDL1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG202670 representing NM_016467
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACGTTGGAGTTGCCCACAGTGAAGTGAATCCAAATACCCGTGTCATGAACAGCCGGGGTATGTGGC
TGACATATGCATTGGGAGTTGGCTTGCTTCATATTGTCTTACTCAGCATTCCCTTCTTCAGTGTTCCTGT
TGCTTGGACTTTAACAAATATTATACATAATCTGGGGATGTACGTATTTTTGCATGCAGTGAAAGGAACA
CCTTTCGAAACTCCTGACCAGGGTAAAGCAAGGCTCCTAACTCATTGGGAACAACTGGACTATGGAGTAC
AGTTTACATCTTCACGGAAGTTTTTCACAATTTCTCCAATAATTCTATATTTTCTGGCAAGTTTCTATAC
GAAGTATGATCCAACTCACTTCATCCTAAACACAGCTTCTCTCCTGAGTGTACTAATTCCCAAAATGCCA
CAACTACATGGTGTTCGGATCTTTGGAATTAATAAGTAT

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG202670 representing NM_016467
Red=Cloning site Green=Tags(s)

MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFFSVPVAWTLTNIIHNLGMYVFLHAVKGT
PFETPDQGKARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYDPTHFILNTASLLSVLIPKMP
QLHGVRIFGINKY

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_016467
ORF Size 459 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016467.5
RefSeq Size 2018 bp
RefSeq ORF 462 bp
Locus ID 94101
UniProt ID Q9P0S3
Cytogenetics 2q32.2
Domains ORMDL
Protein Families Transmembrane
Summary Negative regulator of sphingolipid synthesis.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_016467" in other vectors (6)
SKU Description Size Price
RC202670 ORMDL1 (Myc-DDK-tagged)-Human ORM1-like 1 (S. cerevisiae) (ORMDL1), transcript variant 1 10 ug
$150.00
RC202670L1 Lenti ORF clone of Human ORM1-like 1 (S. cerevisiae) (ORMDL1), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC202670L2 Lenti ORF clone of Human ORM1-like 1 (S. cerevisiae) (ORMDL1), transcript variant 1, mGFP tagged 10 ug
$450.00
RC202670L3 Lenti ORF clone of Human ORM1-like 1 (S. cerevisiae) (ORMDL1), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC202670L4 Lenti ORF clone of Human ORM1-like 1 (S. cerevisiae) (ORMDL1), transcript variant 1, mGFP tagged 10 ug
$450.00
SC114235 ORMDL1 (untagged)-Human ORM1-like 1 (S. cerevisiae) (ORMDL1), transcript variant 1 10 ug
$150.00

Plasmid Map for RG202670

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG202670
Circular map for RG202670

file-alt Citations

Expression of the ORMDLS, Modulators of Serine Palmitoyltransferase, is Regulated by Sphingolipids in Mammalian Cells
Gupta, Gable, Alexaki et al
J. Biol. Chem. (2014)
AI Summary: OriGene products contributed to this study by providing plasmids containing human LCB1 and LCB2a cDNAs, as well as a C-terminally tagged ORMDL1-GFP in the pcMV6-AC-GFP vector, which were used to investigate the regulation of sphingolipid biosynthesis in mammalian cells.
Snippet: Plasmids containing the human LCB1 and LCB2a cDNAs under the control of CMV promoter were purchased from OriGene Technologies, Inc. ... The C-terminally tagged ORMDL1-GFP in the pcMV6-AC-GFP vector was purchased from OriGene Technologies, Inc. ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products