OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LIMD2 (NM_030576) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG202586
LIMD2 (tGFP-tagged) - Human LIM domain containing 2 (LIMD2)
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $489.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "LIMD2 or NM_030576"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LIMD2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG202586 representing NM_030576
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCCAGGCTGCAGGAGCCGCCCAGGCCACCCCCTCTCATGACGCCAAAGGCGGCGGCAGCAGCACGG
TGCAGCGCTCCAAGTCCTTCAGCCTGCGGGCCCAGGTGAAGGAGACCTGCGCCGCCTGCCAGAAGACCGT
GTACCCCATGGAGCGGCTGGTGGCCGACAAGCTCATTTTCCACAACTCTTGCTTCTGCTGCAAGCACTGT
CACACCAAGCTCAGCCTGGGCAGCTACGCCGCGCTGCACGGGGAGTTCTACTGCAAACCCCACTTCCAGC
AGCTGTTTAAGAGCAAAGGCAACTACGACGAGGGGTTTGGCCGCAAGCAGCACAAGGAGCTCTGGGCCCA
CAAGGAGGTGGACCCCGGCACCAAGACGGCC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG202586 representing NM_030576
Red=Cloning site Green=Tags(s)

MFQAAGAAQATPSHDAKGGGSSTVQRSKSFSLRAQVKETCAACQKTVYPMERLVADKLIFHNSCFCCKHC
HTKLSLGSYAALHGEFYCKPHFQQLFKSKGNYDEGFGRKQHKELWAHKEVDPGTKTA

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_030576
ORF Size 381 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_030576.4
RefSeq Size 3178 bp
RefSeq ORF 384 bp
Locus ID 80774
UniProt ID Q9BT23
Cytogenetics 17q23.3
Summary Acts as an activator of the protein-kinase ILK, thereby regulating cell motility (PubMed:24590809).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_030576" in other vectors (4)
SKU Description Size Price
RC202586 LIMD2 (Myc-DDK-tagged)-Human LIM domain containing 2 (LIMD2) 10 ug
$150.00
RC202586L3 Lenti ORF clone of Human LIM domain containing 2 (LIMD2), Myc-DDK-tagged 10 ug
$450.00
RC202586L4 Lenti ORF clone of Human LIM domain containing 2 (LIMD2), mGFP tagged 10 ug
$450.00
SC109913 LIMD2 (untagged)-Human LIM domain containing 2 (LIMD2) 10 ug
$150.00

Plasmid Map for RG202586

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG202586
Circular map for RG202586

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products