OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FOXA3 (NM_004497) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG202363
FOXA3 (tGFP-tagged) - Human forkhead box A3 (FOXA3)
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
  $886.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA329710 Rabbit Polyclonal Anti-FOXA3 Antibody
100 ul
$585.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "FOXA3 or NM_004497"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FOXA3
Synonyms FKHH3; HNF3G; TCF3G
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG202363 representing NM_004497
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGGGCTCAGTGAAGATGGAGGCCCATGACCTGGCCGAGTGGAGCTACTACCCGGAGGCGGGCGAGG
TCTACTCGCCGGTGACCCCAGTGCCCACCATGGCCCCCCTCAACTCCTACATGACCCTGAATCCTCTAAG
CTCTCCCTATCCCCCTGGGGGGCTCCCTGCCTCCCCACTGCCCTCAGGACCCCTGGCACCCCCAGCACCT
GCAGCCCCCCTGGGGCCCACTTTCCCAGGCCTGGGTGTCAGCGGTGGCAGCAGCAGCTCCGGGTACGGGG
CCCCGGGTCCTGGGCTGGTGCACGGGAAGGAGATGCCGAAGGGGTATCGGCGGCCCCTGGCACACGCCAA
GCCACCGTATTCCTATATCTCACTCATCACCATGGCCATCCAGCAGGCGCCGGGCAAGATGCTGACCTTG
AGTGAAATCTACCAGTGGATCATGGACCTCTTCCCTTACTACCGGGAGAATCAGCAGCGCTGGCAGAACT
CCATTCGCCACTCGCTGTCTTTCAACGACTGCTTCGTCAAGGTGGCGCGTTCCCCAGACAAGCCTGGCAA
GGGCTCCTACTGGGCCCTACACCCCAGCTCAGGGAACATGTTTGAGAATGGCTGCTACCTGCGCCGCCAG
AAACGCTTCAAGCTGGAGGAGAAGGTGAAAAAAGGGGGCAGCGGGGCTGCCACCACCACCAGGAACGGGA
CAGGGTCTGCTGCCTCGACCACCACCCCCGCGGCCACAGTCACCTCCCCGCCCCAGCCCCCGCCTCCAGC
CCCTGAGCCTGAGGCCCAGGGCGGGGAAGATGTGGGGGCTCTGGACTGTGGCTCACCCGCTTCCTCCACA
CCCTATTTCACTGGCCTGGAGCTCCCAGGGGAGCTGAAGCTGGACGCGCCCTACAACTTCAACCACCCTT
TCTCCATCAACAACCTAATGTCAGAACAGACACCAGCACCTCCCAAACTGGACGTGGGGTTTGGGGGCTA
CGGGGCTGAAGGTGGGGAGCCTGGAGTCTACTACCAGGGCCTCTATTCCCGCTCTTTGCTTAATGCATCC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG202363 representing NM_004497
Red=Cloning site Green=Tags(s)

MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGPLAPPAP
AAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTL
SEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQ
KRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASST
PYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_004497
ORF Size 1050 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004497.3
RefSeq Size 2046 bp
RefSeq ORF 1053 bp
Locus ID 3171
UniProt ID P55318
Cytogenetics 19q13.32
Protein Families ES Cell Differentiation/IPS, Transcription Factors
Protein Pathways Maturity onset diabetes of the young
Summary This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_004497" in other vectors (6)
SKU Description Size Price
RC202363 FOXA3 (Myc-DDK-tagged)-Human forkhead box A3 (FOXA3) 10 ug
$686.00
RC202363L1 Lenti ORF clone of Human forkhead box A3 (FOXA3), Myc-DDK-tagged 10 ug
$986.00
RC202363L2 Lenti ORF clone of Human forkhead box A3 (FOXA3), mGFP tagged 10 ug
$986.00
RC202363L3 Lenti ORF clone of Human forkhead box A3 (FOXA3), Myc-DDK-tagged 10 ug
$986.00
RC202363L4 Lenti ORF clone of Human forkhead box A3 (FOXA3), mGFP tagged 10 ug
$986.00
SC122681 FOXA3 (untagged)-Human forkhead box A3 (FOXA3) 10 ug
$686.00

Plasmid Map for RG202363

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG202363
Circular map for RG202363

file-alt Citations

MMP1 expression is activated by Slug and enhances multi-drug resistance (MDR) in breast cancer
Shen, Kuo, Chen et al
PLoS ONE (2017) 12 (3), e0174487 DOI: 10.1371/journal.pone.0174487
AI Summary: OriGene products, specifically the Human Slug (Snai2/Slug, NM_003068) cDNA ORF clone (cat. RG202363), Human MMP1 (NM_002421) cDNA ORF Clone (cat. RG202460), and the empty control pCMV6-AC-GFP vector (cat. PS100010), were used to manipulate gene expression and investigate the roles of Slug and MMP1 in breast cancer drug resistance in this study.
Snippet: Human Slug (Snai2/Slug, NM_003068) cDNA ORF clone (cat. RG202363), Human MMP1 (NM_002421) cDNA ORF Clone (cat. RG202460) and the empty control pCMV6-AC-GFP vector (cat. PS100010) were purchased from OriGene (Rockville, MD, USA). ... All 3 versions Cite SaveSaving
Slug contributes to cancer progression by direct regulation of ERα signaling pathway
Li, Wu, Abbatiello et al
Int. J. Oncol. (2015) 46 (4), 1461-72 DOI: 10.3892/ijo.2015.2878
Cited by 46
AI Summary: OriGene products, specifically the SNAI2 human cDNA ORF clone (cat. RC202363) and the pCMV6-AC-gFP vector (cat. PS100010), were used to stably overexpress Slug in MCF7 cells, enabling the study of Slug's role in regulating ERα expression and cancer progression.
Snippet: Rg202363) and pCMV6-AC-gFP vector (cat. PS100010) were purchased from Origene (Rockville, MD, USA). MCF7 cells were stably transfected with either the SNAI2 human cDNA ORF clone (MCF7/Slug) or pCMV6-AC-gFP vector (MCF7/V) using lipofectamine 2000 ... Cite SaveSaving
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products