OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PARK7 (NM_007262) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG201645
PARK7 (tGFP-tagged) - Human Parkinson disease (autosomal recessive, early onset) 7 (PARK7), transcript variant 1
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$489.00 $500.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA591026 Rabbit monoclonal anti-PARK7 antibody for SISCAPA, clone OTIR4F10
100 ul
$519.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "PARK7 or NM_007262"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PARK7
Synonyms DJ-1; DJ1; GATD2; HEL-S-67p
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201645 representing NM_007262
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTCCAAAAGAGCTCTGGTCATCCTGGCTAAAGGAGCAGAGGAAATGGAGACGGTCATCCCTGTAG
ATGTCATGAGGCGAGCTGGGATTAAGGTCACCGTTGCAGGCCTGGCTGGAAAAGACCCAGTACAGTGTAG
CCGTGATGTGGTCATTTGTCCTGATGCCAGCCTTGAAGATGCAAAAAAAGAGGGACCATATGATGTGGTG
GTTCTACCAGGAGGTAATCTGGGTGCACAGAATTTATCTGAGTCTGCTGCTGTGAAGGAGATACTGAAGG
AGCAGGAAAACCGGAAGGGCCTGATAGCCGCCATCTGTGCAGGTCCTACTGCTCTGTTGGCTCATGAAAT
AGGTTTTGGAAGTAAAGTTACAACACACCCTCTTGCTAAAGACAAAATGATGAATGGAGGTCATTACACC
TACTCTGAGAATCGTGTGGAAAAAGACGGCCTGATTCTTACAAGCCGGGGGCCTGGGACCAGCTTCGAGT
TTGCGCTTGCAATTGTTGAAGCCCTGAATGGCAAGGAGGTGGCGGCTCAAGTGAAGGCTCCACTTGTTCT
TAAAGAC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201645 representing NM_007262
Red=Cloning site Green=Tags(s)

MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVV
VLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYT
YSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_007262
ORF Size 567 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007262.3, NP_009193.2
RefSeq Size 906 bp
RefSeq ORF 570 bp
Locus ID 11315
UniProt ID Q99497
Cytogenetics 1p36.23
Domains DJ-1_PfpI
Protein Families Druggable Genome, Protease
Protein Pathways Parkinson's disease
Summary The product of this gene belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7. Two transcript variants encoding the same protein have been identified for this gene. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_007262" in other vectors (6)
SKU Description Size Price
RC201645 PARK7 (Myc-DDK-tagged)-Human Parkinson disease (autosomal recessive, early onset) 7 (PARK7), transcript variant 1 10 ug
$300.00
RC201645L1 Lenti ORF clone of Human Parkinson disease (autosomal recessive, early onset) 7 (PARK7), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC201645L2 Lenti ORF clone of Human Parkinson disease (autosomal recessive, early onset) 7 (PARK7), transcript variant 1, mGFP tagged 10 ug
$600.00
RC201645L3 Lenti ORF clone of Human Parkinson disease (autosomal recessive, early onset) 7 (PARK7), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC201645L4 Lenti ORF clone of Human Parkinson disease (autosomal recessive, early onset) 7 (PARK7), transcript variant 1, mGFP tagged 10 ug
$600.00
SC115623 PARK7 (untagged)-Human Parkinson disease (autosomal recessive, early onset) 7 (PARK7), transcript variant 1 10 ug
$300.00

Plasmid Map for RG201645

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG201645
Circular map for RG201645

file-alt Citations

DJ-1 is an essential downstream mediator in PINK1/parkin-dependent mitophagy
Imberechts, Kinnart, Wauters et al
Brain (2022) 145 (12), 4368-4384 DOI: 10.1093/brain/awac313
Cited by 155
AI Summary: OriGene products contributed to this study by providing the goat anti-FLAG antibody (TA150080) used for immunofluorescence and the pCMV6-AC-GFP empty vector (PS100010) and pCMV6-AC-GFP vector containing human DJ-1 cDNA (RG201645) for expression studies, enabling investigation of DJ-1’s role in mitophagy.
Snippet: hospho-ubiquitinS65 (WB, 1:1000;IF, 1:250;Sigma, ABS1513-I), mouse anti-FLAG (WB, 1:1000;IF, 1:500;Sigma, F3165), rabbit anti-FLAG (WB, 1:1000;IF, 1:500 Sigma, F7425), goat anti-FLAG (IF, 1/500;Origene, TA150080), mouse anti-GTP cyclohydrolase 1 (PLA, 1:50;Abnova, H00002643-M01), mouse antiprotein disulphide isomerase (PLA, 1:500;Enzo Life Sciences, ADI-SPA-891), mouse anti-EEA1 (PLA, 1/50;- A pCMV6-AC-GFP empty 15 vector and pCMV6-AC-GFP vector containing cDNA for human DJ-1 were purchased from 16 Origene (PS100010 and RG201645,
WB IF
The Parkinsonism-associated protein DJ-1/Park7 prevents glycation damage in human keratinocyte
Advedissian, Deshayes, Poirier et al
Biochem. Biophys. Res. Commun. (2016)
Cited by 34
AI Summary: In this study, OriGene's DJ-1-specific siRNAs (SR307752) and control scrambled siRNA were used to deplete DJ-1 in HaCaT keratinocytes, enabling the authors to assess DJ-1's role in preventing protein glycation.
Snippet: Exponentially growing HaCaT cells at 30% confluency were transfected with three distinct siRNAs specific for DJ-1 and a control scrambled siRNA (50 nM each, SR307752, Origene) using the transfection reagent Lipofectamine RNAiMAX (13778-150, Life Technologies ... Cite SaveSaving
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products