OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RPL10 (NM_006013) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG201613
RPL10 (tGFP-tagged) - Human ribosomal protein L10 (RPL10), transcript variant 1
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$489.00 $500.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA807662 RPL10 mouse monoclonal antibody, clone OTI6B11 (formerly 6B11) 100 ul
$447.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "RPL10 or NM_006013"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RPL10
Synonyms AUTSX5; DXS648; DXS648E; L10; MRXS35; NOV; QM
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201613 representing NM_006013
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCCGCCGCCCCGCCCGTTGTTACCGGTATTGTAAGAACAAGCCGTACCCAAAGTCTCGCTTCTGCC
GAGGTGTCCCTGATGCCAAGATTCGCATTTTTGACCTGGGGCGGAAAAAGGCAAAAGTGGATGAGTTTCC
GCTTTGTGGCCACATGGTGTCAGATGAATATGAGCAGCTGTCCTCTGAAGCCCTGGAGGCTGCCCGAATT
TGTGCCAATAAGTACATGGTAAAAAGTTGTGGCAAAGATGGCTTCCATATCCGGGTGCGGCTCCACCCCT
TCCACGTCATCCGCATCAACAAGATGTTGTCCTGTGCTGGGGCTGACAGGCTCCAAACAGGCATGCGAGG
TGCCTTTGGAAAGCCCCAGGGCACTGTGGCCAGGGTTCACATTGGCCAAGTTATCATGTCCATCCGCACC
AAGCTGCAGAACAAGGAGCATGTGATTGAGGCCCTGCGCAGGGCCAAGTTCAAGTTTCCTGGCCGCCAGA
AGATCCACATCTCAAAGAAGTGGGGCTTCACCAAGTTCAATGCTGATGAATTTGAAGACATGGTGGCTGA
AAAGCGGCTCATCCCAGATGGCTGTGGGGTCAAGTACATCCCCAGTCGTGGCCCTCTGGACAAGTGGCGG
GCCCTGCACTCA

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201613 representing NM_006013
Red=Cloning site Green=Tags(s)

MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSEALEAARI
CANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT
KLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPSRGPLDKWR
ALHS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_006013
ORF Size 642 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006013.5
RefSeq Size 2188 bp
RefSeq ORF 645 bp
Locus ID 6134
UniProt ID P27635
Cytogenetics Xq28
Domains Ribosomal_L10e
Protein Families Druggable Genome
Protein Pathways Ribosome
Summary This gene encodes a ribosomal protein that is a component of the 60S ribosome subunit. The related protein in chicken can bind to c-Jun and can repress c-Jun-mediated transcriptional activation. Some studies have detected an association between variation in this gene and autism spectrum disorders, though others do not detect this relationship. There are multiple pseudogenes of this gene dispersed throughout the genome. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jan 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_006013" in other vectors (6)
SKU Description Size Price
RC201613 RPL10 (Myc-DDK-tagged)-Human ribosomal protein L10 (RPL10), transcript variant 1 10 ug
$300.00
RC201613L1 Lenti ORF clone of Human ribosomal protein L10 (RPL10), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC201613L2 Lenti ORF clone of Human ribosomal protein L10 (RPL10), transcript variant 1, mGFP tagged 10 ug
$600.00
RC201613L3 Lenti ORF clone of Human ribosomal protein L10 (RPL10), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC201613L4 Lenti ORF clone of Human ribosomal protein L10 (RPL10), transcript variant 1, mGFP tagged 10 ug
$600.00
SC116356 RPL10 (untagged)-Human ribosomal protein L10 (RPL10), transcript variant 1 10 ug
$300.00

Plasmid Map for RG201613

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG201613
Circular map for RG201613

file-alt Citations

Omomyc Reveals New Mechanisms To Inhibit the MYC Oncogene
Demma, Mapelli, Sun et al
Mol. Cell. Biol. (2019) 39 (22) DOI: 10.1128/MCB.00248-19
AI Summary: In this study, OriGene’s pCMV6-AC-GFP and pCMV6-AC-GFP-RPL10 plasmids were used to facilitate the translating ribosome affinity purification (TRAP) assay, enabling the investigation of Omomyc’s interactions with ribosomes and elucidating its mechanism of MYC inhibition.
Snippet: Translating ribosome affinity purification assay.The translating ribosome affinity purification (TRAP) assay was performed according to methods described previously by Heiman et al. (48), with minor modifications. HCT116 cells were transiently transfected with pCMV6-AC-GFP or pCMV6-AC-GFP-RPL10 (Origene, Rockville, MD) using Lipofectamine 2000 (Thermo-Fisher, Waltham, MA). …
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products