OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DYNLT3 (NM_006520) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG201525
DYNLT3 (tGFP-tagged) - Human dynein, light chain, Tctex-type 3 (DYNLT3)
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $489.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "DYNLT3 or NM_006520"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DYNLT3
Synonyms RP3; TCTE1L; TCTEX1L
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201525 representing NM_006520
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAGTACCATCGCCACTGCGACGAGGTTGGCTTCAATGCTGAGGAAGCCCACAATATTGTCAAAG
AGTGTGTAGATGGGGTTTTAGGTGGTGAAGATTATAATCACAACAACATCAACCAGTGGACTGCAAGCAT
AGTGGAACAATCCTTAACACACCTGGTTAAGTTGGGAAAAGCCTATAAATATATTGTGACCTGTGCAGTG
GTCCAGAAGAGCGCATATGGCTTTCACACAGCCAGCTCCTGTTTTTGGGATACCACATCTGATGGAACCT
GTACCGTAAGATGGGAGAACCGGACCATGAACTGTATTGTCAACGTTTTTGCCATTGCTATTGTTCTT

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201525 representing NM_006520
Red=Cloning site Green=Tags(s)

MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAV
VQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_006520
ORF Size 348 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006520.3
RefSeq Size 2156 bp
RefSeq ORF 351 bp
Locus ID 6990
UniProt ID P51808
Cytogenetics Xp11.4
Domains Tctex-1
Summary This gene encodes a member of a subclass of dynein light chains. The encoded protein homodimerizes and forms the light chain component of the cytoplasmic dynein motor protein complex. This protein may be important for binding dynein to specific cargos including the spindle checkpoint protein BUB3. This protein may also function independently of dynein as a transcriptional modulator. Pseudogenes of this gene are found on chromosomes 2 and 20.provided by RefSeq, Mar 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_006520" in other vectors (6)
SKU Description Size Price
RC201525 DYNLT3 (Myc-DDK-tagged)-Human dynein, light chain, Tctex-type 3 (DYNLT3) 10 ug
$150.00
RC201525L1 Lenti ORF clone of Human dynein, light chain, Tctex-type 3 (DYNLT3), Myc-DDK-tagged 10 ug
$450.00
RC201525L2 Lenti ORF clone of Human dynein, light chain, Tctex-type 3 (DYNLT3), mGFP tagged 10 ug
$450.00
RC201525L3 Lenti ORF clone of Human dynein, light chain, Tctex-type 3 (DYNLT3), Myc-DDK-tagged 10 ug
$450.00
RC201525L4 Lenti ORF clone of Human dynein, light chain, Tctex-type 3 (DYNLT3), mGFP tagged 10 ug
$450.00
SC116013 DYNLT3 (untagged)-Human dynein, light chain, Tctex-type 3 (DYNLT3) 10 ug
$150.00

Plasmid Map for RG201525

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG201525
Circular map for RG201525

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products