OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MTCH2 (NM_014342) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG201473
MTCH2 (tGFP-tagged) - Human mitochondrial carrier 2 (MTCH2), nuclear gene encoding mitochondrial protein
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$489.00 $500.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA350187 Rabbit Polyclonal Anti-MTCH2 Antibody
100 ul
$205.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "MTCH2 or NM_014342"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MTCH2
Synonyms HSPC032; MIMP; SLC25A50
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201473 representing NM_014342
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGACGCGGCCAGTCAGGTGCTCCTGGGCTCCGGTCTCACCATCCTGTCCCAGCCGCTCATGTACG
TGAAAGTGCTCATCCAGGTGGGATATGAGCCTCTTCCTCCAACAATAGGACGAAATATTTTTGGGCGGCA
AGTGTGTCAGCTTCCTGGTCTCTTTAGTTATGCTCAGCACATTGCCAGTATCGATGGGAGGCGCGGGTTG
TTCACAGGCTTAACTCCAAGACTGTGTTCGGGAGTCCTTGGAACTGTGGTCCATGGTAAAGTTTTACAGC
ATTACCAGGAGAGTGACAAGGGTGAGGAGTTAGGACCTGGAAATGTACAGAAAGAAGTCTCATCTTCCTT
TGACCACGTTATCAAGGAGACAACTCGAGAGATGATCGCTCGTTCTGCTGCTACCCTCATCACACATCCC
TTCCATGTGATCACTCTGAGATCTATGGTACAGTTCATTGGCAGAGAATCCAAGTACTGTGGACTTTGTG
ATTCCATAATAACCATCTATCGGGAAGAGGGCATTCTAGGATTTTTCGCGGGTCTTGTTCCTCGCCTTCT
AGGTGACATCCTTTCTTTGTGGCTGTGTAACTCACTGGCCTACCTCGTCAATACCTATGCACTGGACAGT
GGGGTTTCTACCATGAATGAAATGAAGAGTTATTCTCAAGCTGTCACAGGATTTTTTGCGAGTATGTTGA
CCTATCCCTTTGTGCTTGTCTCCAATCTTATGGCTGTCAACAACTGTGGTCTTGCTGGTGGATGCCCTCC
TTACTCCCCAATATATACGTCTTGGATAGACTGTTGGTGCATGCTACAAAAAGAGGGGAATATGAGCCGA
GGAAATAGCTTATTTTTCCGGAAGGTCCCCTTTGGGAAGACTTATTGTTGTGACCTGAAAATGTTAATT

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201473 representing NM_014342
Red=Cloning site Green=Tags(s)

MADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGL
FTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVIKETTREMIARSAATLITHP
FHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGFFAGLVPRLLGDILSLWLCNSLAYLVNTYALDS
GVSTMNEMKSYSQAVTGFFASMLTYPFVLVSNLMAVNNCGLAGGCPPYSPIYTSWIDCWCMLQKEGNMSR
GNSLFFRKVPFGKTYCCDLKMLI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_014342
ORF Size 909 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014342.4
RefSeq Size 2524 bp
RefSeq ORF 912 bp
Locus ID 23788
UniProt ID Q9Y6C9
Cytogenetics 11p11.2
Domains mito_carr
Summary This gene encodes a member of the SLC25 family of nuclear-encoded transporters that are localized in the inner mitochondrial membrane. Members of this superfamily are involved in many metabolic pathways and cell functions. Genome-wide association studies in human have identified single-nucleotide polymorphisms in several loci associated with obesity. This gene is one such locus, which is highly expressed in white adipose tissue and adipocytes, and thought to play a regulatory role in adipocyte differentiation and biology. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target that can produce two isoforms from the same mRNA by use of alternative in-frame translation termination codons. provided by RefSeq, Dec 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_014342" in other vectors (7)
SKU Description Size Price
RC201473 MTCH2 (Myc-DDK-tagged)-Human mitochondrial carrier 2 (MTCH2), nuclear gene encoding mitochondrial protein 10 ug
$300.00
RC201473L1 Lenti ORF clone of Human mitochondrial carrier 2 (MTCH2), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC201473L2 Lenti ORF clone of Human mitochondrial carrier 2 (MTCH2), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
RC201473L3 Lenti ORF clone of Human mitochondrial carrier 2 (MTCH2), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC201473L4 Lenti ORF clone of Human mitochondrial carrier 2 (MTCH2), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
SC115052 MTCH2 (untagged)-Human mitochondrial carrier 2 (MTCH2), nuclear gene encoding mitochondrial protein 10 ug
$300.00
SC324067 MTCH2 (untagged)-Human mitochondrial carrier 2 (MTCH2), nuclear gene encoding mitochondrial protein 10 ug
$300.00

Plasmid Map for RG201473

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG201473
Circular map for RG201473

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products