OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PSMD8 (NM_002812) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG200436
PSMD8 (tGFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 (PSMD8)
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$489.00 $500.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA322953 Anti-PSMD8 Rabbit Polyclonal Antibody
100 ul
$305.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "PSMD8 or NM_002812"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PSMD8
Synonyms HEL-S-91n; HIP6; HYPF; Nin1p; p31; Rpn12; S14
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG200436 representing NM_002812
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTACGAGCAACTCAAGGGCGAGTGGAACCGTAAAAGCCCCAATCTTAGCAAGTGCGGGGAAGAGCTGG
GTCGACTCAAGCTAGTTCTTCTGGAGCTCAACTTCTTGCCAACCACAGGGACCAAGCTGACCAAACAGCA
GCTAATTCTGGCCCGTGACATACTGGAGATCGGGGCCCAATGGAGCATCCTACGCAAGGACATCCCCTCC
TTCGAGCGCTACATGGCCCAGCTCAAATGCTACTACTTTGATTACAAGGAGCAGCTCCCCGAGTCAGCCT
ATATGCACCAGCTCTTGGGCCTCAACCTCCTCTTCCTGCTGTCCCAGAACCGGGTGGCTGAGTTCCACAC
GGAGTTGGAGCGGCTGCCTGCCAAGGACATACAGACCAATGTCTACATCAAGCACCCAGTGTCCCTGGAG
CAATACCTGATGGAGGGCAGCTACAACAAAGTGTTCCTGGCCAAGGGTAACATCCCCGCCGAGAGCTACA
CCTTCTTCATTGACATCCTGCTCGACACTATCAGGGATGAGATCGCTGGGTGCATCGAGAAGGCCTACGA
GAAAATCCTTTTCACTGAGGCCACCCGGATCCTCTTCTTCAACACACCCAAAAAGATGACAGACTACGCC
AAGAAGCGAGGGTGGGTCCTGGGCCCCAACAACTACTACAGTTTTGCCAGCCAGCAGCAGAAGCCGGAAG
ACACCACCATTCCCTCCACAGAACTGGCCAAACAGGTCATCGAGTATGCCCGGCAGCTGGAGATGATCGT
C

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200436 representing NM_002812
Red=Cloning site Green=Tags(s)

MYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPS
FERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLE
QYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYA
KKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_002812
ORF Size 771 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002812.3, NP_002803.1
RefSeq Size 1556 bp
RefSeq ORF 1053 bp
Locus ID 5714
UniProt ID P48556
Cytogenetics 19q13.2
Domains Nin1_C
Protein Pathways Proteasome
Summary The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. A pseudogene has been identified on chromosome 1. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_002812" in other vectors (7)
SKU Description Size Price
RC200436 PSMD8 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 (PSMD8) 10 ug
$300.00
RC200436L1 Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 (PSMD8), Myc-DDK-tagged 10 ug
$600.00
RC200436L2 Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 (PSMD8), mGFP tagged 10 ug
$600.00
RC200436L3 Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 (PSMD8), Myc-DDK-tagged 10 ug
$600.00
RC200436L4 Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 (PSMD8), mGFP tagged 10 ug
$600.00
SC128196 PSMD8 (untagged)-Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 (PSMD8) 10 ug
$300.00
SC317552 PSMD8 (untagged)-Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 (PSMD8) 10 ug
$503.00

Plasmid Map for RG200436

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG200436
Circular map for RG200436

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products