OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DNAJB11 (NM_016306) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG200216
DNAJB11 (tGFP-tagged) - Human DnaJ (Hsp40) homolog, subfamily B, member 11 (DNAJB11)
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$489.00 $657.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA365110 DNAJB11 rabbit polyclonal antibody
100 ul
$310.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "DNAJB11 or NM_016306"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DNAJB11
Synonyms ABBP-2; ABBP2; Dj-9; DJ9; EDJ; ERdj3; ERj3; ERj3p; PKD6; PRO1080; UNQ537
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG200216 representing NM_016306
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCCGCAGAACCTGAGCACCTTTTGCCTGTTGCTGCTATACCTCATCGGGGCGGTGATTGCCGGAC
GAGATTTCTATAAGATCTTGGGGGTGCCTCGAAGTGCCTCTATAAAGGATATTAAAAAGGCCTATAGGAA
ACTAGCCCTGCAGCTTCATCCCGACCGGAACCCTGATGATCCACAAGCCCAGGAGAAATTCCAGGATCTG
GGTGCTGCTTATGAGGTTCTGTCAGATAGTGAGAAACGGAAACAGTACGATACTTATGGTGAAGAAGGAT
TAAAAGATGGTCATCAGAGCTCCCATGGAGACATTTTTTCACACTTCTTTGGGGATTTTGGTTTCATGTT
TGGAGGAACCCCTCGTCAGCAAGACAGAAATATTCCAAGAGGAAGTGATATTATTGTAGATCTAGAAGTC
ACTTTGGAAGAAGTATATGCAGGAAATTTTGTGGAAGTAGTTAGAAACAAACCTGTGGCAAGGCAGGCTC
CTGGCAAACGGAAGTGCAATTGTCGGCAAGAGATGCGGACCACCCAGCTGGGCCCTGGGCGCTTCCAAAT
GACCCAGGAGGTGGTCTGCGACGAATGCCCTAATGTCAAACTAGTGAATGAAGAACGAACGCTGGAAGTA
GAAATAGAGCCTGGGGTGAGAGACGGCATGGAGTACCCCTTTATTGGAGAAGGTGAGCCTCACGTGGATG
GGGAGCCTGGAGATTTACGGTTCCGAATCAAAGTTGTCAAGCACCCAATATTTGAAAGGAGAGGAGATGA
TTTGTACACAAATGTGACAATCTCATTAGTTGAGTCACTGGTTGGCTTTGAGATGGATATTACTCACTTG
GATGGTCACAAGGTACATATTTCCCGGGATAAGATCACCAGGCCAGGAGCGAAGCTATGGAAGAAAGGGG
AAGGGCTCCCCAACTTTGACAACAACAATATCAAGGGCTCTTTGATAATCACTTTTGATGTGGATTTTCC
AAAAGAACAGTTAACAGAGGAAGCGAGAGAAGGTATCAAACAGCTACTGAAACAAGGGTCAGTGCAGAAG
GTATACAATGGACTGCAAGGATAT

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200216 representing NM_016306
Red=Cloning site Green=Tags(s)

MAPQNLSTFCLLLLYLIGAVIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDL
GAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEV
TLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEV
EIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPIFERRGDDLYTNVTISLVESLVGFEMDITHL
DGHKVHISRDKITRPGAKLWKKGEGLPNFDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQK
VYNGLQGY

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_016306
ORF Size 1074 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016306.6
RefSeq Size 1723 bp
RefSeq ORF 1077 bp
Locus ID 51726
UniProt ID Q9UBS4
Cytogenetics 3q27.3
Domains DnaJ, DnaJ_C
Protein Families Transmembrane
Summary This gene encodes a soluble glycoprotein of the endoplasmic reticulum (ER) lumen that functions as a co-chaperone of binding immunoglobulin protein, a 70 kilodalton heat shock protein chaperone required for the proper folding and assembly of proteins in the ER. The encoded protein contains a highly conserved J domain of about 70 amino acids with a characteristic His-Pro-Asp (HPD) motif and may regulate the activity of binding immunoglobulin protein by stimulating ATPase activity. provided by RefSeq, Mar 2014
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_016306" in other vectors (6)
SKU Description Size Price
RC200216 DNAJB11 (Myc-DDK-tagged)-Human DnaJ (Hsp40) homolog, subfamily B, member 11 (DNAJB11) 10 ug
$457.00
RC200216L1 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily B, member 11 (DNAJB11), Myc-DDK-tagged 10 ug
$757.00
RC200216L2 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily B, member 11 (DNAJB11), mGFP tagged 10 ug
$757.00
RC200216L3 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily B, member 11 (DNAJB11), Myc-DDK-tagged 10 ug
$757.00
RC200216L4 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily B, member 11 (DNAJB11), mGFP tagged 10 ug
$757.00
SC319479 DNAJB11 (untagged)-Human DnaJ (Hsp40) homolog, subfamily B, member 11 (DNAJB11) 10 ug
$457.00

Plasmid Map for RG200216

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG200216
Circular map for RG200216

file-alt Citations

HSP90 inhibitors reduce cholesterol storage in Niemann-Pick type C1 mutant fibroblasts
Pipalia, Saad, Subramanian et al
J Lipid Res (2021) 62, 100114 DOI: 10.1016/j.jlr.2021.100114
Cited by 17
AI Summary: OriGene products contributed to this study by providing the human HSPA1A (NM_005345) Myc-DDK-tagged ORF cDNA clone, which was used to overexpress HSP70 and assess its effect on cholesterol storage in NPC1 mutant fibroblasts.
FigureFigureFigure
HSP90 inhibitors reduce cholesterol storage in Niemann-Pick type C1 mutant fibroblasts
Pipalia, Saad, Subramanian et al
Journal of Lipid Research (2021)
Cited by 17
AI Summary: In this study, the OriGene product eGFP-HSP40 (DNAJB11 (NM_016306) Human Tagged ORF Clone, Cat# RG200216) was used to investigate the role of molecular chaperones in reducing cholesterol storage in NPC1 mutant fibroblasts.
Snippet: eGFP-HSP40 (DNAJB11 (NM_016306) Human Tagged ORF Clone, Cat# RG200216, Origene Technologies) plasmid using an Amaxa human dermal fibroblast kit and T20 protocol
Erdj3 has an essential role for Z variant Alpha-1-Antitrypsin Degradation
Khodayari, Marek, Lu et al
J. Cell. Biochem. (2017)
AI Summary: In this study, the OriGene pCMV6-DNAJB11 plasmid was used to overexpress ERdj3 in AAT knockout Huh7.5 cells, enabling the authors to assess the role of ERdj3 in Z variant alpha-1-antitrypsin degradation.
Snippet: To investigate the effect of ERdj3 overexpression, AAT KO Huh7.5 cells were co-transfected with GFP tagged pCMV6-DNAJB11 (OriGene, Rockville, MD) and pTR2-ZAAT or pTR2-MAAT;48 hours post transfection, they were evaluated by native gel Western blotting ... Cite SaveSaving
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products