OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CHMP2A (NM_014453) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG200068
CHMP2A (tGFP-tagged) - Human chromatin modifying protein 2A (CHMP2A), transcript variant 1
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $500.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA358063 CHMP2A Antibody - C-terminal region
100 ul
$585.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "CHMP2A or NM_014453"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CHMP2A
Synonyms BC-2; BC2; CHMP2; VPS2; VPS2A
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG200068 representing NM_014453
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCTATTGTTCGGGCGCCGGAAGACGCCAGAGGAGCTACTGCGGCAGAACCAGAGGGCCCTGAACC
GTGCCATGCGGGAGCTGGACCGCGAGCGACAGAAACTAGAGACCCAGGAGAAGAAAATCATTGCAGACAT
TAAGAAGATGGCCAAGCAAGGCCAGATGGATGCTGTTCGCATCATGGCAAAAGACTTGGTGCGCACCCGG
CGCTATGTGCGCAAGTTTGTATTGATGCGGGCCAACATCCAGGCTGTGTCCCTCAAGATCCAGACACTCA
AGTCCAACAACTCGATGGCACAAGCCATGAAGGGTGTCACCAAGGCCATGGGCACCATGAACAGACAGCT
GAAGTTGCCCCAGATCCAGAAGATCATGATGGAGTTTGAGCGGCAGGCAGAGATCATGGATATGAAGGAG
GAGATGATGAATGATGCCATTGATGATGCCATGGGTGATGAGGAAGATGAAGAGGAGAGTGATGCTGTGG
TGTCCCAGGTTCTGGATGAGCTGGGACTTAGCCTAACAGATGAGCTGTCGAACCTCCCCTCAACTGGGGG
CTCGCTTAGTGTGGCTGCTGGTGGGAAAAAAGCAGAGGCCGCAGCCTCAGCCCTAGCTGATGCTGATGCA
GACCTGGAGGAACGGCTTAAGAACCTGCGGAGGGAC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200068 representing NM_014453
Red=Cloning site Green=Tags(s)

MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTR
RYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKE
EMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADA
DLEERLKNLRRD

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_014453
ORF Size 666 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014453.4
RefSeq Size 926 bp
RefSeq ORF 669 bp
Locus ID 27243
UniProt ID O43633
Cytogenetics 19q13.43
Domains DUF279
Protein Pathways Endocytosis
Summary CHMP2A belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 PubMed 16730941).supplied by OMIM, Mar 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_014453" in other vectors (6)
SKU Description Size Price
RC200068 CHMP2A (Myc-DDK-tagged)-Human chromatin modifying protein 2A (CHMP2A), transcript variant 1 10 ug
$300.00
RC200068L1 Lenti ORF clone of Human chromatin modifying protein 2A (CHMP2A), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC200068L2 Lenti ORF clone of Human chromatin modifying protein 2A (CHMP2A), transcript variant 1, mGFP tagged 10 ug
$600.00
RC200068L3 Lenti ORF clone of Human chromatin modifying protein 2A (CHMP2A), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC200068L4 Lenti ORF clone of Human chromatin modifying protein 2A (CHMP2A), transcript variant 1, mGFP tagged 10 ug
$600.00
SC319048 CHMP2A (untagged)-Human chromatin modifying protein 2A (CHMP2A), transcript variant 1 10 ug
$300.00

Plasmid Map for RG200068

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG200068
Circular map for RG200068

file-alt Citations

CHMP2A regulates tumor sensitivity to natural killer cell-mediated cytotoxicity
Bernareggi, Xie, Prager et al
Nat Commun (2022) 13 (1), 1899 DOI: 10.1038/s41467-022-29469-0
Cited by 73
AI Summary: OriGene’s CHMP2A (NM_014453) Human Tagged ORF Clone was used to generate CHMP2A-overexpressing CAL27 cells, enabling the authors to study the role of CHMP2A in tumor resistance to NK cell-mediated cytotoxicity.
Snippet: Lee (Nationwide Children’s Hospital) for expansion71. Generation of CHMP2A overexpressing Cal27 In all, 8 × 105 cells Cal27-KO were transfected with CHMP2A (NM_014453) Human Tagged ORF Clone (Origene) via nucleofection using Amaxa 2D (Lonza) and Cell Line Nucleofector Kit V (Lonza) following manufacturer’s protocol. After nucleofection cells were seeded in six-well plates and 24 h late
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products