OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DAZAP2 (NM_014764) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG200047
DAZAP2 (tGFP-tagged) - Human DAZ associated protein 2 (DAZAP2), transcript variant 1
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $500.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA331247 Rabbit Polyclonal Anti-DAZAP2 Antibody
100 ul
$585.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "DAZAP2 or NM_014764"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DAZAP2
Synonyms PRTB
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG200047 representing NM_014764
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACAGCAAAGGTCAATATCCAACACAGCCAACCTACCCTGTGCAGCCTCCTGGGAATCCAGTATACC
CTCAGACCTTGCATCTTCCTCAGGCTCCACCCTATACCGATGCTCCACCTGCCTACTCAGAGCTCTATCG
TCCGAGCTTTGTGCACCCAGGGGCTGCCACAGTCCCCACCATGTCAGCCGCATTTCCTGGAGCCTCTCTG
TATCTTCCCATGGCCCAGTCTGTGGCTGTTGGGCCTTTAGGTTCCACAATCCCCATGGCTTATTATCCAG
TCGGTCCCATCTATCCACCTGGCTCCACAGTGCTGGTGGAAGGAGGGTATGATGCAGGTGCCAGATTTGG
AGCTGGGGCTACTGCTGGCAACATTCCTCCTCCACCTCCTGGATGCCCTCCCAATGCTGCTCAGCTTGCA
GTCATGCAGGGAGCCAACGTCCTCGTAACTCAGCGGAAGGGGAACTTCTTCATGGGTGGTTCAGATGGTG
GCTACACCATCTGG

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200047 representing NM_014764
Red=Cloning site Green=Tags(s)

MNSKGQYPTQPTYPVQPPGNPVYPQTLHLPQAPPYTDAPPAYSELYRPSFVHPGAATVPTMSAAFPGASL
YLPMAQSVAVGPLGSTIPMAYYPVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLA
VMQGANVLVTQRKGNFFMGGSDGGYTIW

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_014764
ORF Size 504 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014764.4
RefSeq Size 1916 bp
RefSeq ORF 507 bp
Locus ID 9802
UniProt ID Q15038
Cytogenetics 12q13.13
Summary This gene encodes a proline-rich protein which interacts with the deleted in azoospermia (DAZ) and the deleted in azoospermia-like gene through the DAZ-like repeats. This protein also interacts with the transforming growth factor-beta signaling molecule SARA (Smad anchor for receptor activation), eukaryotic initiation factor 4G, and an E3 ubiquitinase that regulates its stability in splicing factor containing nuclear speckles. The encoded protein may function in various biological and pathological processes including spermatogenesis, cell signaling and transcription regulation, formation of stress granules during translation arrest, RNA splicing, and pathogenesis of multiple myeloma. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Oct 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_014764" in other vectors (6)
SKU Description Size Price
RC200047 DAZAP2 (Myc-DDK-tagged)-Human DAZ associated protein 2 (DAZAP2), transcript variant 1 10 ug
$289.00 $300.00
RC200047L1 Lenti ORF clone of Human DAZ associated protein 2 (DAZAP2), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC200047L2 Lenti ORF clone of Human DAZ associated protein 2 (DAZAP2), transcript variant 1, mGFP tagged 10 ug
$600.00
RC200047L3 Lenti ORF clone of Human DAZ associated protein 2 (DAZAP2), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC200047L4 Lenti ORF clone of Human DAZ associated protein 2 (DAZAP2), transcript variant 1, mGFP tagged 10 ug
$600.00
SC114859 DAZAP2 (untagged)-Human DAZ associated protein 2 (DAZAP2), transcript variant 1 10 ug
$300.00

Plasmid Map for RG200047

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG200047
Circular map for RG200047

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products