OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AKR1D1 (NM_001190907) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC231133
AKR1D1 (Myc-DDK-tagged)-Human aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) (AKR1D1), transcript variant 3
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA324085 Anti-AKR1D1 rabbit polyclonal antibody
100 ul
$305.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "AKR1D1 or NM_001190907"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol AKR1D1
Synonyms 3o5bred; CBAS2; SRD5B1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC231133 representing NM_001190907
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATCTCAGTGCTGCAAGTCACCGCATACCTCTAAGTGATGGAAACAGCATTCCCATCATCGGACTTG
GTACCTACTCAGAACCTAAATCGACCCCTAAGGGAGCCTGTGCAACATCGGTGAAGGTTGCTATTGACAC
AGGGTACCGACATATTGATGGGGCCTACATCTACCAAAATGAACACGAAGTTGGGGAGGCCATCAGGGAG
AAGATAGCAGAAGGAAAGGTGCGGAGGGAAGATATCTTCTACTGTGGAAAGCTATGGGCTACAAATCATG
TCCCAGAGATGGTCCGCCCAACCCTGGAGAGGACACTCAGGGTCCTCCAGCTAGATTATGTGGATCTTTA
CATCATTGAAGTACCCATGGCCTTTAAGCCAGGAGATGAAATATACCCTAGAGATGAGAATGGCAAATGG
TTATATCACAAGTCAAATCTGTGTGCCACTTGGGAGGCGATGGAAGCTTGCAAAGACGCTGGCTTGGTGA
AATCCCTGGGAGTGTCCAATTTTAACCGCAGGCAGCTGGAGCTCATCCTGAACAAGCCAGGACTCAAACA
CAAGCCAGTCAGCAACCAGGTTGAGTGCCATCCGTATTTCACCCAGCCAAAACTCTTGAAATTTTGCCAA
CAACATGACATTGTCATTACTGCATATAGCCCTTTGGGGACCAGTAGGAATCCAATCTGGGTGAATGTTT
CTTCTCCACCTTTGTTAAAGGATGCACTTCTAAACTCATTGGGGAAAAGGTACAATAAGACAGCAGCTCA
AATTGTTTTGCGTTTCAACATCCAGCGAGGGGTGGTTGTCATTCCTAAAAGCTTTAATCTTGAAAGGATC
AAAGAAAATTTTCAGGTGGCGCGATCATCC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC231133 representing NM_001190907
Red=Cloning site Green=Tags(s)

MDLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIRE
KIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKW
LYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQ
QHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERI
KENFQVARSS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001190907
ORF Size 870 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001190907.2
RefSeq ORF 873 bp
Locus ID 6718
UniProt ID P51857
Cytogenetics 7q33
Protein Families Druggable Genome
Protein Pathways Androgen and estrogen metabolism, C21-Steroid hormone metabolism, Metabolic pathways, Primary bile acid biosynthesis
MW 33.2 kDa
Summary The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet. provided by RefSeq, Jul 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001190907" in other vectors (3)
SKU Description Size Price
RC231133L3 Lenti-ORF clone of AKR1D1 (Myc-DDK-tagged)-Human aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) (AKR1D1), transcript variant 3 10 ug
$600.00
RC231133L4 Lenti-ORF clone of AKR1D1 (mGFP-tagged)-Human aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) (AKR1D1), transcript variant 3 10 ug
$600.00
RG231133 AKR1D1 (tGFP-tagged) - Human aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) (AKR1D1), transcript variant 3 10 ug
$500.00

Plasmid Map for RC231133

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC231133
Circular map for RC231133

file-alt Citations

Differential activity and expression of human 5β-reductase (AKR1D1) splice variants
Appanna, Gibson, Gangitano et al
J Mol Endocrinol (2021) 66 (3), 181-194 DOI: 10.1530/JME-20-0160
AI Summary: In this study, OriGene products—including AKR1D1 Myc-DDK tagged ORF cDNA clones and anti-DDK (FLAG) antibodies—were used to overexpress and detect AKR1D1 splice variants in HEK293 cells, enabling the researchers to analyze their expression, stability, and roles in steroid hormone metabolism.
FigureFigureFigure
Differential activity and expression of human 5β-reductase (AKR1D1) splice variants
Appanna, Gangitano, Dempster et al
bioRxiv (2020)
Cited by 2
Snippet: pCMV6 vector 145 (#PCMV6XL4), pCMV6+AKR1D1-002 (#SC116410), pCMV6+AKR1D1-001 (#RC231126) or 146 pCMV6+AKR1D1-006 (#RC231133) construct variants (Origene Technologies, Rockville, 147 USA). 0.5 µg
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products